DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and sp8b

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_005158015.1 Gene:sp8b / 324931 ZFINID:ZDB-GENE-030131-3654 Length:455 Species:Danio rerio


Alignment Length:260 Identity:84/260 - (32%)
Similarity:109/260 - (41%) Gaps:67/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QEPEAITIKTELASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHSSYTRTSTP-LLDAAP 99
            |.|....::|.|.|        |...::..|.....||..|    :|:||:::.:::| ||....
Zfish   185 QNPNGAALQTSLHS--------GGLQTSLHSPLGGYNSDYS----SLSHSAFSTSASPHLLTTGQ 237

  Fly   100 H------PVF-SHPQSSPLDTHAAA--------TASLAPPNQHAPFLSAASDLYYAAAAAAAAAA 149
            |      ||. |:|.|||.....|.        ||||           |.|....|...:..|..
Zfish   238 HLMDGFKPVLSSYPDSSPSPLGGAGGSMLTGGPTASL-----------AGSPRSSARRYSGRATC 291

  Fly   150 STPTAVPGFGMDPFTMGLMEQEYARVMAEDAQL--KALNSRKQRPKKFKC--PNCDVAFSNNGQL 210
            ..|..               ||..|:....|.|  |.|:|         |  |.|...:.....|
Zfish   292 DCPNC---------------QEAERLGPAGASLRRKGLHS---------CHIPGCGKVYGKTSHL 332

  Fly   211 KGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTH 275
            |.|:|.|||||||.|:...|||.|||::||.||.|.|||.:.:.|..|.|:|.|.|||.||:|||
Zfish   333 KAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHVKTH 397

  Fly   276  275
            Zfish   398  397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 31/67 (46%)
zf-C2H2 195..217 CDD:278523 7/23 (30%)
C2H2 Zn finger 197..217 CDD:275368 7/21 (33%)
zf-H2C2_2 210..236 CDD:290200 16/25 (64%)
C2H2 Zn finger 225..247 CDD:275368 12/21 (57%)
zf-H2C2_2 239..264 CDD:290200 12/24 (50%)
C2H2 Zn finger 255..275 CDD:275368 11/19 (58%)
sp8bXP_005158015.1 C2H2 Zn finger 320..339 CDD:275368 6/18 (33%)
zf-H2C2_2 331..358 CDD:290200 16/26 (62%)
C2H2 Zn finger 347..369 CDD:275368 12/21 (57%)
zf-H2C2_2 361..384 CDD:290200 11/22 (50%)
zf-C2H2 375..397 CDD:278523 11/21 (52%)
C2H2 Zn finger 377..397 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.