DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and sp5l

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_919352.1 Gene:sp5l / 324261 ZFINID:ZDB-GENE-030131-2981 Length:357 Species:Danio rerio


Alignment Length:288 Identity:80/288 - (27%)
Similarity:117/288 - (40%) Gaps:69/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DGDFSSASS-----SASSSSNSSKSCYEEALN--HSSYTRTSTPLLDAAPHPVFSH-------PQ 107
            :|...||||     |...:.|||.|.::....  ...:.....|.|.:..|....|       |.
Zfish    53 EGPVGSASSMFQLWSNDVAPNSSLSAHQMTFTVPKMQFPSHMQPTLGSHSHHHHHHHHHHHELPL 117

  Fly   108 SSPLDTHAAATASLAPPNQ--HAPFL---SAASDLYYAAAAAAAAAASTP--------------- 152
            :.|.:..:|.:..|:|...  :||:.   :|.|..:.:.....:..|..|               
Zfish   118 TPPAEPPSAYSFELSPVKMQGNAPYYTQHNAVSQNFPSFLQNPSGRAHLPGGHVEDGQQWWSLPQ 182

  Fly   153 --TAVPGFGMDPFTMG----LMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNCD---------- 201
              :|..|   .||::|    |..|.....:.:... |.|.|..:|.::.|||||.          
Zfish   183 GNSAPSG---HPFSLGRQLVLGHQPQIAALLQGTS-KGLLSSTRRCRRCKCPNCQSTGNGGAALE 243

  Fly   202 ---------------VAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLR 251
                           ..:.....||.|:|.|.|||||.|:...|||:|||::||.||.|.|||.:
Zfish   244 FGKKRLHICHIPDCGKVYKKTSHLKAHLRWHAGERPFICNWLFCGKSFTRSDELQRHLRTHTGEK 308

  Fly   252 PYPCSACGKKFGRRDHLKKHMKTHMPQE 279
            .:.|..|||:|.|.|||.||:|||..::
Zfish   309 RFGCQQCGKRFMRSDHLSKHVKTHQSRK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 33/90 (37%)
zf-C2H2 195..217 CDD:278523 9/46 (20%)
C2H2 Zn finger 197..217 CDD:275368 8/44 (18%)
zf-H2C2_2 210..236 CDD:290200 15/25 (60%)
C2H2 Zn finger 225..247 CDD:275368 12/21 (57%)
zf-H2C2_2 239..264 CDD:290200 13/24 (54%)
C2H2 Zn finger 255..275 CDD:275368 12/19 (63%)
sp5lNP_919352.1 C2H2 Zn finger 255..274 CDD:275368 4/18 (22%)
zf-C2H2 280..304 CDD:278523 13/23 (57%)
C2H2 Zn finger 282..304 CDD:275368 12/21 (57%)
zf-H2C2_2 296..319 CDD:290200 12/22 (55%)
C2H2 Zn finger 312..332 CDD:275368 12/19 (63%)
zf-C2H2 312..332 CDD:278523 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.