Sequence 1: | NP_524221.1 | Gene: | hkb / 40549 | FlyBaseID: | FBgn0261434 | Length: | 297 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259388.1 | Gene: | Sp1 / 31913 | FlyBaseID: | FBgn0020378 | Length: | 726 | Species: | Drosophila melanogaster |
Alignment Length: | 329 | Identity: | 99/329 - (30%) |
---|---|---|---|
Similarity: | 129/329 - (39%) | Gaps: | 97/329 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 ITIKTELASS--SFGHDCDGDFSSASSSASSSSNSS-KSCYEEALNHSSYTRTSTPLLD------ 96
Fly 97 ----------AAPHPVFS-HPQSSPL----------------DTHAAATA--SLAPPNQHAPFLS 132
Fly 133 AASDLY-------------------------------------------YAAAAAAAAAASTPTA 154
Fly 155 VPG---FGMDPFTMGLMEQ-EYA-RVM--------AEDAQLKALNSRKQRPKKFKCPNCDVAFSN 206
Fly 207 NGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKH 271
Fly 272 MKTH 275 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hkb | NP_524221.1 | COG5048 | 195..>261 | CDD:227381 | 30/65 (46%) |
zf-C2H2 | 195..217 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 197..217 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 210..236 | CDD:290200 | 16/25 (64%) | ||
C2H2 Zn finger | 225..247 | CDD:275368 | 12/21 (57%) | ||
zf-H2C2_2 | 239..264 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 255..275 | CDD:275368 | 11/19 (58%) | ||
Sp1 | NP_001259388.1 | C2H2 Zn finger | 390..409 | CDD:275368 | 6/18 (33%) |
zf-H2C2_2 | 401..428 | CDD:290200 | 16/26 (62%) | ||
C2H2 Zn finger | 417..439 | CDD:275368 | 12/21 (57%) | ||
zf-H2C2_2 | 431..454 | CDD:290200 | 11/22 (50%) | ||
zf-C2H2 | 445..467 | CDD:278523 | 11/21 (52%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 11/19 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23235 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |