DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and Sp1

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster


Alignment Length:329 Identity:99/329 - (30%)
Similarity:129/329 - (39%) Gaps:97/329 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ITIKTELASS--SFGHDCDGDFSSASSSASSSSNSS-KSCYEEALNHSSYTRTSTPLLD------ 96
            ||....||||  :.|....|..||||.|.|||:.|: .:.|...|   .:..|||..:|      
  Fly   142 ITASRPLASSCAAVGGGSTGSSSSASGSQSSSTASAVAAAYGGDL---YFPNTSTSNMDNHHMHQ 203

  Fly    97 ----------AAPHPVFS-HPQSSPL----------------DTHAAATA--SLAPPNQHAPFLS 132
                      ||...|:| ||...|.                |.|:||.:  .:.....|:...:
  Fly   204 GLLGKVEAGAAAFGGVYSRHPYDWPFNAVTHKEAASVNSGWWDMHSAAGSWLDMGGAGMHSTMAN 268

  Fly   133 AASDLY-------------------------------------------YAAAAAAAAAASTPTA 154
            .||:.|                                           :::.:||||||:|..|
  Fly   269 YASENYSSALSHSLLGSGQHLLQDTYKSMLPGQGVGVGVGVGMGGFSLPHSSPSAAAAAAATAAA 333

  Fly   155 VPG---FGMDPFTMGLMEQ-EYA-RVM--------AEDAQLKALNSRKQRPKKFKCPNCDVAFSN 206
            ..|   .|..|.|.....| .|| |..        ||......::.||:.......|.|...:..
  Fly   334 AAGGSPQGGSPSTPSPRSQRRYAGRATCDCPNCQEAERLGPAGVHLRKKNIHSCHIPGCGKVYGK 398

  Fly   207 NGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKH 271
            ...||.|:|.|||||||.|:...|||.|||::||.||.|.|||.:.:.|..|.|:|.|.|||.||
  Fly   399 TSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLAKH 463

  Fly   272 MKTH 275
            :|||
  Fly   464 VKTH 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 30/65 (46%)
zf-C2H2 195..217 CDD:278523 6/21 (29%)
C2H2 Zn finger 197..217 CDD:275368 6/19 (32%)
zf-H2C2_2 210..236 CDD:290200 16/25 (64%)
C2H2 Zn finger 225..247 CDD:275368 12/21 (57%)
zf-H2C2_2 239..264 CDD:290200 12/24 (50%)
C2H2 Zn finger 255..275 CDD:275368 11/19 (58%)
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 6/18 (33%)
zf-H2C2_2 401..428 CDD:290200 16/26 (62%)
C2H2 Zn finger 417..439 CDD:275368 12/21 (57%)
zf-H2C2_2 431..454 CDD:290200 11/22 (50%)
zf-C2H2 445..467 CDD:278523 11/21 (52%)
C2H2 Zn finger 447..467 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.