DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and Klf15

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster


Alignment Length:282 Identity:74/282 - (26%)
Similarity:114/282 - (40%) Gaps:89/282 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GDFSSASSSAS-SSSNSSKSCYEEA-------LNHSSYTRTSTPLLDAAPH-------------- 100
            |:|.|.....| |..|.::..:||:       |:.::.|.|:..:....||              
  Fly    34 GEFDSTYVDTSFSGGNYNQLEFEESDYYGIITLDSNNNTNTNGNIQVGLPHVEDPSLFIDFNDLT 98

  Fly   101 ---PVFSH-------------------PQSSPLDTHAAA------TASL---APPNQH--APFLS 132
               |..|.                   |:.:||.|...|      .::|   .||:..  .|..|
  Fly    99 VCPPDLSDWEQRLLDNYVEIPDLVDFLPERTPLCTDNCADFLEESNSNLRLSGPPHSEIFVPDRS 163

  Fly   133 AASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKC 197
            ::|. ..:.:|:.|.|.:.|:|:.                   |:|:|         ...:.:.|
  Fly   164 SSSP-GSSDSASPAEAVAPPSALQ-------------------MSENA---------AGERGYLC 199

  Fly   198 P--NCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGK 260
            .  ||:..::....||.|:|.|.||:|:.|....|...|:|::||.||||.|:|::||.|..|.|
  Fly   200 TFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSK 264

  Fly   261 KFGRRDHLKKHMKTHMPQERQL 282
            .|.|.|||.||.|.|   ||:|
  Fly   265 CFARSDHLTKHRKVH---ERRL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 27/67 (40%)
zf-C2H2 195..217 CDD:278523 7/23 (30%)
C2H2 Zn finger 197..217 CDD:275368 7/21 (33%)
zf-H2C2_2 210..236 CDD:290200 11/25 (44%)
C2H2 Zn finger 225..247 CDD:275368 10/21 (48%)
zf-H2C2_2 239..264 CDD:290200 14/24 (58%)
C2H2 Zn finger 255..275 CDD:275368 11/19 (58%)
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 35/78 (45%)
C2H2 Zn finger 203..221 CDD:275368 6/17 (35%)
C2H2 Zn finger 229..251 CDD:275368 10/21 (48%)
zf-H2C2_2 243..268 CDD:290200 14/24 (58%)
C2H2 Zn finger 259..279 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.