DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and KLF15

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_011511045.1 Gene:KLF15 / 28999 HGNCID:14536 Length:435 Species:Homo sapiens


Alignment Length:304 Identity:82/304 - (26%)
Similarity:114/304 - (37%) Gaps:84/304 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLHP-----PQTYSRLFRPWDTQRQAATSAAPRTVKQEPEAITIKTELASSSFGHD-CDGDFSSA 63
            |:.|     |:..|:     |....:..||.|.           |:.|...|.|.: |......|
Human   170 NMEPGVKEVPEGNSK-----DLDACSQLSAGPH-----------KSHLHPGSSGRERCSPPPGGA 218

  Fly    64 SSSASSSSNSSKSCYEEALNHSSYTRTSTP------LLDAAPHPVFSHPQSSPLDTHAAATASLA 122
            |:..:......                .||      ||...|.||.....:.|      |:...|
Human   219 SAGGAQGPGGG----------------PTPDGPIPVLLQIQPVPVKQESGTGP------ASPGQA 261

  Fly   123 PPNQH---------------APFLSAASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMG----LM 168
            |.|..               .|.:..:|:|  ...:.....|..|.|....|..|...|    ||
Human   262 PENVKVAQLLVNIQGQTFALVPQVVPSSNL--NLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLM 324

  Fly   169 EQEYARVMAEDAQLKALNSRKQRPKKFKC--PNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCG 231
            .|::.:           |...:..|..||  |.|...::.:..||.|:|.||||:||.|....||
Human   325 GQKFPK-----------NPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCG 378

  Fly   232 KTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTH 275
            ..|:|::||:||:|.|:|::||.|..|.|||.|.|||.||:|.|
Human   379 WRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVH 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 30/67 (45%)
zf-C2H2 195..217 CDD:278523 8/23 (35%)
C2H2 Zn finger 197..217 CDD:275368 7/21 (33%)
zf-H2C2_2 210..236 CDD:290200 14/25 (56%)
C2H2 Zn finger 225..247 CDD:275368 10/21 (48%)
zf-H2C2_2 239..264 CDD:290200 14/24 (58%)
C2H2 Zn finger 255..275 CDD:275368 12/19 (63%)
KLF15XP_011511045.1 zf-C2H2 340..364 CDD:278523 8/23 (35%)
zf-C2H2_8 342..421 CDD:292531 38/78 (49%)
C2H2 Zn finger 342..364 CDD:275368 7/21 (33%)
zf-H2C2_2 356..383 CDD:290200 14/26 (54%)
C2H2 Zn finger 372..394 CDD:275368 10/21 (48%)
zf-H2C2_2 386..411 CDD:290200 14/24 (58%)
C2H2 Zn finger 402..422 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4986
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.