DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and luna

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster


Alignment Length:282 Identity:86/282 - (30%)
Similarity:136/282 - (48%) Gaps:64/282 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VKQEPEAITIK-TELASSSFGHDCDGDFS--SASSSASSSSNSSKSCYEEALNHSSYTRTSTPLL 95
            ::|:.:.:.:: ..::..:.||...|..|  |:|||:|:|||||.|      :|||    |:.:.
  Fly   314 LQQQQQQLAVQHLSISPQALGHSNIGSNSPKSSSSSSSNSSNSSSS------SHSS----SSSIS 368

  Fly    96 DAAPHPVFSH-PQSS--PLDT----HAAATASLAPPNQH--------APFLSAASDLYYAAAAAA 145
            .::..|..|: |:|:  .|.|    ..||..|||...|.        |..||||::...:.:.:.
  Fly   369 GSSDQPTHSNIPRSTIVRLTTANGKPGAAGISLARVIQMQNNGNANVAAVLSAAANSGSSNSNSN 433

  Fly   146 AAAASTP-----TAVPGFGMDPFTMGLMEQEYARVMAEDAQLKALNSRK-QRPKK---------- 194
            :::::|.     ||.|            :|:   |:::.::..|..|.| ..|::          
  Fly   434 SSSSNTSSNSINTATP------------QQQ---VLSQRSEKSANGSSKPHHPRQHHSDHSPDAK 483

  Fly   195 ---FKCP--NCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYP 254
               .||.  .|...::.:..||.|.|.||||:|:||....|...|.|::|||||.|.|||.:|:.
  Fly   484 RRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFK 548

  Fly   255 CSACGKKFGRRDHLKKHMKTHM 276
            |..|.:.|.|.|||..|||.||
  Fly   549 CRNCDRCFSRSDHLALHMKRHM 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 29/67 (43%)
zf-C2H2 195..217 CDD:278523 7/23 (30%)
C2H2 Zn finger 197..217 CDD:275368 6/21 (29%)
zf-H2C2_2 210..236 CDD:290200 13/25 (52%)
C2H2 Zn finger 225..247 CDD:275368 10/21 (48%)
zf-H2C2_2 239..264 CDD:290200 13/24 (54%)
C2H2 Zn finger 255..275 CDD:275368 10/19 (53%)
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 34/103 (33%)
C2H2 Zn finger 489..511 CDD:275368 6/21 (29%)
zf-H2C2_2 503..>519 CDD:290200 9/15 (60%)
C2H2 Zn finger 519..541 CDD:275368 10/21 (48%)
zf-H2C2_2 533..558 CDD:290200 13/24 (54%)
C2H2 Zn finger 549..569 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.