DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment hkb and Zfp41

DIOPT Version :9

Sequence 1:	NP_524221.1	Gene:	hkb / 40549	FlyBaseID:	FBgn0261434	Length:	297	Species:	Drosophila melanogaster
Sequence 2:	NP_001038183.1	Gene:	Zfp41 / 22701	MGIID:	99186	Length:	198	Species:	Mus musculus

Alignment Length:	86	Identity:	41/86 - (47%)
Similarity:	54/86 - (62%)	Gaps:	2/86 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   190 QRPKKFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYP 254
            ||.|.::|..|...|.:......|.|:||||:|||||  .|||||..:.::|:|:|||||.:|:.
Mouse    82 QRKKPYECGECGRIFKHKTDHIRHQRVHTGEKPFKCD--QCGKTFRHSSDVTKHQRIHTGEKPFK 144

  Fly   255 CSACGKKFGRRDHLKKHMKTH 275
            |..|||.|....:|.||.|||
Mouse   145 CGECGKAFNCGSNLLKHQKTH 165

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
hkb	NP_524221.1	COG5048	195..>261	CDD:227381	30/65 (46%)
		zf-C2H2	195..217	CDD:278523	5/21 (24%)
		C2H2 Zn finger	197..217	CDD:275368	5/19 (26%)
		zf-H2C2_2	210..236	CDD:290200	16/25 (64%)
		C2H2 Zn finger	225..247	CDD:275368	10/21 (48%)
		zf-H2C2_2	239..264	CDD:290200	13/24 (54%)
		C2H2 Zn finger	255..275	CDD:275368	9/19 (47%)
Zfp41	NP_001038183.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..56
		C2H2 Zn finger	89..109	CDD:275368	5/19 (26%)
		SFP1	<111..191	CDD:227516	31/57 (54%)
		C2H2 Zn finger	117..137	CDD:275368	10/21 (48%)
		C2H2 Zn finger	145..165	CDD:275368	9/19 (47%)
		C2H2 Zn finger	173..193	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S2592
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.950