| Sequence 1: | NP_524221.1 | Gene: | hkb / 40549 | FlyBaseID: | FBgn0261434 | Length: | 297 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_033265.4 | Gene: | Sp4 / 20688 | MGIID: | 107595 | Length: | 782 | Species: | Mus musculus |
| Alignment Length: | 333 | Identity: | 82/333 - (24%) |
|---|---|---|---|
| Similarity: | 122/333 - (36%) | Gaps: | 89/333 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 PPQTYSRLFRPWDTQRQAATSAAPRTVKQE-----------PEAITIKTELASSSFGHDCDGDFS 61
Fly 62 SASSSASSSSNSSKSCYEEALNHSSYTRT------STPLLDAAPHPVFSHPQSSPLDTHAAATAS 120
Fly 121 LAPPN----------------QHAP--FLSAASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGL 167
Fly 168 ME-QEYARVMAEDAQLKALNSRKQRPKKFK-----CPN------------------------CDV 202
Fly 203 AFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDH 267
Fly 268 LKKHMKTH 275 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| hkb | NP_524221.1 | COG5048 | 195..>261 | CDD:227381 | 31/94 (33%) |
| zf-C2H2 | 195..217 | CDD:278523 | 7/50 (14%) | ||
| C2H2 Zn finger | 197..217 | CDD:275368 | 7/43 (16%) | ||
| zf-H2C2_2 | 210..236 | CDD:290200 | 15/25 (60%) | ||
| C2H2 Zn finger | 225..247 | CDD:275368 | 12/21 (57%) | ||
| zf-H2C2_2 | 239..264 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 255..275 | CDD:275368 | 11/19 (58%) | ||
| Sp4 | NP_033265.4 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..48 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 107..148 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 275..385 | ||||
| 9aaTAD, inactive. /evidence=ECO:0000250|UniProtKB:Q02446 | 465..473 | 1/7 (14%) | |||
| C2H2 Zn finger | 647..669 | CDD:275368 | 4/21 (19%) | ||
| COG5048 | <660..731 | CDD:227381 | 38/68 (56%) | ||
| zf-H2C2_2 | 661..688 | CDD:290200 | 15/26 (58%) | ||
| C2H2 Zn finger | 677..699 | CDD:275368 | 12/21 (57%) | ||
| zf-H2C2_2 | 691..714 | CDD:290200 | 11/22 (50%) | ||
| zf-C2H2 | 705..727 | CDD:278523 | 11/21 (52%) | ||
| C2H2 Zn finger | 707..727 | CDD:275368 | 11/19 (58%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||