Sequence 1: | NP_524221.1 | Gene: | hkb / 40549 | FlyBaseID: | FBgn0261434 | Length: | 297 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001955.1 | Gene: | EGR1 / 1958 | HGNCID: | 3238 | Length: | 543 | Species: | Homo sapiens |
Alignment Length: | 327 | Identity: | 95/327 - (29%) |
---|---|---|---|
Similarity: | 134/327 - (40%) | Gaps: | 88/327 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 PPQTYSRLFRPWDTQRQAATSAAP---RTVKQEP-----EAITIKTELASSSFGHDCDGDFSSAS 64
Fly 65 SSASSSSNSSKSCYEEALNHSSYTRTSTPLLDAAP------HPVFSHPQSSPLDTHAAATASLAP 123
Fly 124 PNQHAP-------------FLSAASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGLMEQEYARV 175
Fly 176 MAEDAQ-----LKALNSRKQ--------------RPKK-------FKCP--NCDVAFSNNGQLKG 212
Fly 213 HIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHMP 277
Fly 278 QE 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hkb | NP_524221.1 | COG5048 | 195..>261 | CDD:227381 | 31/67 (46%) |
zf-C2H2 | 195..217 | CDD:278523 | 10/23 (43%) | ||
C2H2 Zn finger | 197..217 | CDD:275368 | 10/21 (48%) | ||
zf-H2C2_2 | 210..236 | CDD:290200 | 13/25 (52%) | ||
C2H2 Zn finger | 225..247 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 239..264 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 255..275 | CDD:275368 | 10/19 (53%) | ||
EGR1 | NP_001955.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..105 | ||
DUF3446 | 135..209 | CDD:314753 | 24/94 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 165..213 | 18/59 (31%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 264..284 | 6/29 (21%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 318..339 | 3/20 (15%) | |||
zf-C2H2 | 338..362 | CDD:306579 | 10/23 (43%) | ||
C2H2 Zn finger | 340..362 | CDD:275368 | 10/21 (48%) | ||
zf-H2C2_2 | 354..379 | CDD:316026 | 13/26 (50%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 382..407 | CDD:316026 | 13/24 (54%) | ||
C2H2 Zn finger | 398..418 | CDD:275368 | 10/19 (53%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 409..487 | 6/14 (43%) | |||
DUF3432 | 447..530 | CDD:288743 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |