DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and sptf-2

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_495833.1 Gene:sptf-2 / 188733 WormBaseID:WBGene00011926 Length:166 Species:Caenorhabditis elegans


Alignment Length:178 Identity:46/178 - (25%)
Similarity:77/178 - (43%) Gaps:46/178 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 AATASLAPPNQHAPFLSAASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGLMEQEYARVMAEDA 180
            |||....|...|..:..:...:....:.|:.:|:|:.:::          |..|           
 Worm     4 AATKFFRPWESHGSYHHSLPSISPPDSPASTSASSSSSSI----------GANE----------- 47

  Fly   181 QLKALNSRKQRPKKFKCPNCDV---------------------AFSNNGQLKGHIRIHTGERPFK 224
                |.:::::.::..||||..                     .:.....|:.|:|.|||:|||.
 Worm    48 ----LTTKRRKCERCTCPNCKAIKHGDRGSQHTHLCSVPGCGKTYKKTSHLRAHLRKHTGDRPFV 108

  Fly   225 CDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHM 272
            ||...|||.|.|:::|.||||.||....:.|..|.::|.|.|||::|:
 Worm   109 CDWFDCGKRFDRSDQLIRHKRTHTKEYRFACKFCIRQFSRSDHLQQHL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 29/86 (34%)
zf-C2H2 195..217 CDD:278523 7/42 (17%)
C2H2 Zn finger 197..217 CDD:275368 7/40 (18%)
zf-H2C2_2 210..236 CDD:290200 15/25 (60%)
C2H2 Zn finger 225..247 CDD:275368 12/21 (57%)
zf-H2C2_2 239..264 CDD:290200 10/24 (42%)
C2H2 Zn finger 255..275 CDD:275368 8/18 (44%)
sptf-2NP_495833.1 COG5048 <75..156 CDD:227381 30/80 (38%)
C2H2 Zn finger 82..101 CDD:275368 3/18 (17%)
C2H2 Zn finger 109..131 CDD:275368 12/21 (57%)
C2H2 Zn finger 139..156 CDD:275368 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.