DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and mnm-2

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_509256.2 Gene:mnm-2 / 182489 WormBaseID:WBGene00003380 Length:249 Species:Caenorhabditis elegans


Alignment Length:274 Identity:78/274 - (28%)
Similarity:107/274 - (39%) Gaps:87/274 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KQEPEAITIKTELASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHSSYTRTSTPLLDAAP 99
            ::|.|....:.||:||....:.|.:..||||||||...                          |
 Worm    27 EEEDEEEDEEEELSSSEVTSENDMETESASSSASSVGQ--------------------------P 65

  Fly   100 HPVFS--HPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAAAASTPTAVPGFGMDP 162
            .|.||  |...|.||  .|..|::.....|.|.|......:                       |
 Worm    66 KPDFSAFHKIFSNLD--FAKLAAVKRNGHHQPMLFRPECFF-----------------------P 105

  Fly   163 FTMG----LMEQEYARVMAED------------------AQLKALN---------SRKQRPKKFK 196
            ..:.    |::|.:...:.::                  || |.||         |:|...||::
 Worm   106 LELSKHLHLVQQTFQMNVLQNLGHTLPLPFVPMLKNVAPAQ-KRLNNKRASYVDHSQKGNLKKYR 169

  Fly   197 CPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKK 261
            |..||..||.:..|..|.||||||:||||:  .||:.|.:...||||:..||.::||.|..|.|.
 Worm   170 CDVCDKTFSRSNTLITHKRIHTGEKPFKCE--HCGRAFRQPGNLTRHRLTHTTVKPYVCGLCDKA 232

  Fly   262 FGRRDHLKKHMKTH 275
            |.|..:|..||:||
 Worm   233 FNRASNLHTHMRTH 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 30/65 (46%)
zf-C2H2 195..217 CDD:278523 8/21 (38%)
C2H2 Zn finger 197..217 CDD:275368 8/19 (42%)
zf-H2C2_2 210..236 CDD:290200 15/25 (60%)
C2H2 Zn finger 225..247 CDD:275368 8/21 (38%)
zf-H2C2_2 239..264 CDD:290200 12/24 (50%)
C2H2 Zn finger 255..275 CDD:275368 8/19 (42%)
mnm-2NP_509256.2 zf-C2H2 168..190 CDD:278523 8/21 (38%)
C2H2 Zn finger 170..190 CDD:275368 8/19 (42%)
zf-H2C2_2 183..207 CDD:290200 15/25 (60%)
C2H2 Zn finger 198..218 CDD:275368 8/21 (38%)
zf-H2C2_2 210..235 CDD:290200 12/24 (50%)
zf-C2H2 224..246 CDD:278523 9/21 (43%)
C2H2 Zn finger 226..246 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2592
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.