DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and B0310.2

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_508109.1 Gene:B0310.2 / 180403 WormBaseID:WBGene00015138 Length:413 Species:Caenorhabditis elegans


Alignment Length:259 Identity:71/259 - (27%)
Similarity:98/259 - (37%) Gaps:57/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FSSASS-SASSSSNSSKSCYEEALNHSSYTRTSTP-------LLDAAPHPV-FS----------H 105
            |||..| ....|...:|...|:.:...|...:.:|       :|...|.|: ||          |
 Worm   132 FSSDDSVKGMPSRKRAKRSLEDTVQMLSKENSVSPPPPSLPFVLPQIPVPIPFSNAALMQRWLGH 196

  Fly   106 PQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAAAASTPTAVPGFGM-DPFTMGLME 169
            |.::|        |.|....||.|....:.:.:.|.......||:....||...: :.||....|
 Worm   197 PLTNP--------AYLNAMFQHQPAPKPSEEQFAALMKITMHAANFMKTVPQLPVSNHFTESDAE 253

  Fly   170 QEYARVMAEDAQLKAL-----------NSRKQRPKKFKCPNC---DVAFSNNGQLKGHIRIHTGE 220
            .....|.:::.:::..           .|..........|||   |.|.               |
 Worm   254 DIKIDVESDEGEIEVSPSPSTGDITENESSSSSTGPMISPNCGDGDCAL---------------E 303

  Fly   221 RPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHMPQERQLGP 284
            :||.|..|.|||.|.....|.:|..|||||||:.|..|.|||.|:|:|.:|.|||.|....|||
 Worm   304 KPFICMHNNCGKRFANKFLLKKHMFIHTGLRPHTCPHCHKKFNRKDNLLRHKKTHSPTSAHLGP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 25/68 (37%)
zf-C2H2 195..217 CDD:278523 5/24 (21%)
C2H2 Zn finger 197..217 CDD:275368 5/22 (23%)
zf-H2C2_2 210..236 CDD:290200 9/25 (36%)
C2H2 Zn finger 225..247 CDD:275368 8/21 (38%)
zf-H2C2_2 239..264 CDD:290200 14/24 (58%)
C2H2 Zn finger 255..275 CDD:275368 10/19 (53%)
B0310.2NP_508109.1 C2H2 Zn finger 308..330 CDD:275368 8/21 (38%)
zf-H2C2_2 323..347 CDD:290200 14/23 (61%)
C2H2 Zn finger 338..358 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.