DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and F57C9.4

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_491459.1 Gene:F57C9.4 / 172100 WormBaseID:WBGene00019011 Length:856 Species:Caenorhabditis elegans


Alignment Length:291 Identity:73/291 - (25%)
Similarity:111/291 - (38%) Gaps:50/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LHPPQTYSRLFRPWDTQRQAATSAAPRTVKQEPEAITIKTELASSSFGHDCDGDFSSASSSASSS 70
            :|......|.||.:..:...|...|      .||.: |...|.:|...::   |:|..:.|:...
 Worm   591 MHLQWEQMRKFREYCRKENVACDDA------TPEEM-IAFNLRASKVHYE---DYSPGNVSSEEG 645

  Fly    71 SNSSKSCYEEALNHSSYTRTSTPLLDAAPHPVFSH-------PQSSPLDTHAAATASLAPPNQHA 128
            :.:....:.|.|...|......|.|.:.......|       .||.||      ....:|.:|:.
 Worm   646 NKNEMPNFMEQLEKFSSVIVKGPNLPSTSTMSTMHIKMENGKEQSGPL------LLRNSPNDQNQ 704

  Fly   129 PFLSAASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGLMEQEY--ARVMAEDAQLKALNSRKQR 191
            ..:..   :.|............       .||......||:.:  ..|..|..:.:|..|.:.:
 Worm   705 KVVGV---VQYVICQLCPEEEQK-------SMDLSNQKQMEEHFLNKHVDKEKKKCEACPSDQFQ 759

  Fly   192 PKK------------FKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHK 244
            |..            |.|.:|......| .||.|||.||||||::||  ||.|:||....|.||.
 Worm   760 PHNIGQHYRLHTNSVFACEHCGKRGRRN-FLKTHIRTHTGERPYRCD--TCSKSFTDASTLRRHG 821

  Fly   245 RIHTGLRPYPCSACGKKFGRRDHLKKHMKTH 275
            .:|||.:.|.|..||:...|:|::|.|:::|
 Worm   822 LVHTGEKKYQCPVCGRAIARKDNVKAHIRSH 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 32/65 (49%)
zf-C2H2 195..217 CDD:278523 9/21 (43%)
C2H2 Zn finger 197..217 CDD:275368 8/19 (42%)
zf-H2C2_2 210..236 CDD:290200 17/25 (68%)
C2H2 Zn finger 225..247 CDD:275368 10/21 (48%)
zf-H2C2_2 239..264 CDD:290200 10/24 (42%)
C2H2 Zn finger 255..275 CDD:275368 7/19 (37%)
F57C9.4NP_491459.1 C2H2 Zn finger 750..770 CDD:275368 3/19 (16%)
C2H2 Zn finger 777..796 CDD:275368 8/19 (42%)
zf-H2C2_2 789..812 CDD:290200 16/24 (67%)
zf-C2H2 802..824 CDD:278523 10/23 (43%)
C2H2 Zn finger 804..824 CDD:275368 10/21 (48%)
zf-C2H2 830..852 CDD:278523 8/21 (38%)
C2H2 Zn finger 832..852 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.