DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and ZXDB

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_009088.1 Gene:ZXDB / 158586 HGNCID:13199 Length:803 Species:Homo sapiens


Alignment Length:98 Identity:44/98 - (44%)
Similarity:51/98 - (52%) Gaps:10/98 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 FKC--PNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPC-- 255
            |.|  |.|...:....:||.|:|.|||||||.||.:.||..||...:|.||||.|...|.:.|  
Human   424 FSCSFPGCSKQYDKACRLKIHLRSHTGERPFLCDFDGCGWNFTSMSKLLRHKRKHDDDRRFMCPV 488

  Fly   256 SACGKKFGRRDHLKKHMKTHMPQERQLGPSIFV 288
            ..|||.|.|.:|||.|..||      ||...||
Human   489 EGCGKSFTRAEHLKGHSITH------LGTKPFV 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 31/69 (45%)
zf-C2H2 195..217 CDD:278523 8/23 (35%)
C2H2 Zn finger 197..217 CDD:275368 7/21 (33%)
zf-H2C2_2 210..236 CDD:290200 16/25 (64%)
C2H2 Zn finger 225..247 CDD:275368 11/21 (52%)
zf-H2C2_2 239..264 CDD:290200 12/26 (46%)
C2H2 Zn finger 255..275 CDD:275368 10/21 (48%)
ZXDBNP_009088.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..260
Required for interaction with ZXDC. /evidence=ECO:0000250 271..577 44/98 (45%)
C2H2 Zn finger 273..295 CDD:275368
zf-C2H2_aberr 304..449 CDD:293622 8/24 (33%)
zf-C2H2 304..328 CDD:278523
C2H2 Zn finger 306..328 CDD:275368
C2H2 Zn finger 336..358 CDD:275368
zf-H2C2_2 350..373 CDD:290200
zf-C2H2 364..386 CDD:278523
C2H2 Zn finger 366..386 CDD:275368
C2H2 Zn finger 395..417 CDD:275368
C2H2 Zn finger 429..448 CDD:275368 6/18 (33%)
COG5048 <441..572 CDD:227381 40/81 (49%)
C2H2 Zn finger 456..478 CDD:275368 11/21 (52%)
zf-H2C2_2 471..497 CDD:290200 12/25 (48%)
C2H2 Zn finger 486..508 CDD:275368 10/21 (48%)
C2H2 Zn finger 516..538 CDD:275370 44/98 (45%)
Required for transcriptional activation. /evidence=ECO:0000250 576..703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4986
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.