| Sequence 1: | NP_524221.1 | Gene: | hkb / 40549 | FlyBaseID: | FBgn0261434 | Length: | 297 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021331501.1 | Gene: | LOC110437822 / 110437822 | -ID: | - | Length: | 472 | Species: | Danio rerio |
| Alignment Length: | 204 | Identity: | 56/204 - (27%) |
|---|---|---|---|
| Similarity: | 82/204 - (40%) | Gaps: | 41/204 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 124 PNQHAPFLSAASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGLMEQEYARVMAEDAQLKALNSR 188
Fly 189 KQRPKKFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPY 253
Fly 254 PCSACGKKFGRRDHLKKHMKTH--------------MPQERQLGPSIFV--------------PM 290
Fly 291 YS--YLYGY 297 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| hkb | NP_524221.1 | COG5048 | 195..>261 | CDD:227381 | 27/65 (42%) |
| zf-C2H2 | 195..217 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 197..217 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 210..236 | CDD:290200 | 13/25 (52%) | ||
| C2H2 Zn finger | 225..247 | CDD:275368 | 6/21 (29%) | ||
| zf-H2C2_2 | 239..264 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 255..275 | CDD:275368 | 9/19 (47%) | ||
| LOC110437822 | XP_021331501.1 | C2H2 Zn finger | 197..217 | CDD:275368 | |
| C2H2 Zn finger | 225..245 | CDD:275368 | |||
| C2H2 Zn finger | 267..287 | CDD:275368 | 2/19 (11%) | ||
| C2H2 Zn finger | 295..315 | CDD:275368 | 2/19 (11%) | ||
| zf-C2H2 | 322..343 | CDD:306579 | 8/20 (40%) | ||
| C2H2 Zn finger | 323..343 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 335..359 | CDD:316026 | 12/25 (48%) | ||
| C2H2 Zn finger | 351..371 | CDD:275368 | 6/21 (29%) | ||
| C2H2 Zn finger | 379..399 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 407..427 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 435..455 | CDD:275368 | 5/17 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1591573at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||