DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and wu:fe14d05

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_021331140.1 Gene:wu:fe14d05 / 108183612 ZFINID:ZDB-GENE-030131-4952 Length:390 Species:Danio rerio


Alignment Length:88 Identity:41/88 - (46%)
Similarity:55/88 - (62%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 KKFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSA 257
            |.|.|..|..:||.:..|..|:||||||:||.|  ..|||:|:|:..|.:|.|||||.:|:.|:.
Zfish    20 KPFTCTQCGKSFSRSSSLNHHMRIHTGEKPFTC--TQCGKSFSRSSSLNQHMRIHTGEKPFTCTQ 82

  Fly   258 CGKKFGRRDHLKKHMKTHMPQER 280
            |||.|.:...|.:|||.|...|:
Zfish    83 CGKSFSKLSSLYRHMKIHTGGEK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 32/65 (49%)
zf-C2H2 195..217 CDD:278523 8/21 (38%)
C2H2 Zn finger 197..217 CDD:275368 7/19 (37%)
zf-H2C2_2 210..236 CDD:290200 15/25 (60%)
C2H2 Zn finger 225..247 CDD:275368 9/21 (43%)
zf-H2C2_2 239..264 CDD:290200 13/24 (54%)
C2H2 Zn finger 255..275 CDD:275368 9/19 (47%)
wu:fe14d05XP_021331140.1 COG5048 19..>348 CDD:227381 41/88 (47%)
C2H2 Zn finger 24..44 CDD:275368 7/19 (37%)
C2H2 Zn finger 52..72 CDD:275368 9/21 (43%)
C2H2 Zn finger 80..100 CDD:275368 9/19 (47%)
C2H2 Zn finger 109..129 CDD:275368
C2H2 Zn finger 137..157 CDD:275368
C2H2 Zn finger 165..185 CDD:275368
C2H2 Zn finger 193..213 CDD:275368
C2H2 Zn finger 221..241 CDD:275368
C2H2 Zn finger 249..269 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 305..325 CDD:275368
C2H2 Zn finger 333..353 CDD:275368
zf-H2C2_2 345..370 CDD:316026
C2H2 Zn finger 361..381 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.