DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and LOC101884382

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_009294138.1 Gene:LOC101884382 / 101884382 -ID:- Length:448 Species:Danio rerio


Alignment Length:121 Identity:45/121 - (37%)
Similarity:59/121 - (48%) Gaps:6/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 GMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNCDVAFSNNGQLKGHIRIHTGERPF 223
            |..||......:.:..:    ..||.........|.|.|..|...||....||.|:.:||||:..
Zfish   318 GEKPFVCSHCNKRFTTL----GNLKVHERLHTGEKPFTCTQCWRNFSQLSNLKSHMLVHTGEKTH 378

  Fly   224 KCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHMPQE 279
            |||  .|||||.|..:|.||.|:|:..:||.||.||..|.::.||:.|.|.|..:|
Zfish   379 KCD--QCGKTFLRPSDLKRHLRLHSKEKPYSCSECGNSFTQQSHLEAHQKIHTREE 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 32/65 (49%)
zf-C2H2 195..217 CDD:278523 8/21 (38%)
C2H2 Zn finger 197..217 CDD:275368 7/19 (37%)
zf-H2C2_2 210..236 CDD:290200 15/25 (60%)
C2H2 Zn finger 225..247 CDD:275368 12/21 (57%)
zf-H2C2_2 239..264 CDD:290200 12/24 (50%)
C2H2 Zn finger 255..275 CDD:275368 9/19 (47%)
LOC101884382XP_009294138.1 COG5048 44..437 CDD:227381 45/121 (37%)
C2H2 Zn finger 44..64 CDD:275368
zf-H2C2_2 56..81 CDD:290200
C2H2 Zn finger 72..92 CDD:275368
C2H2 Zn finger 100..120 CDD:275368
C2H2 Zn finger 128..148 CDD:275368
C2H2 Zn finger 156..176 CDD:275368
zf-H2C2_2 168..193 CDD:290200
C2H2 Zn finger 184..204 CDD:275368
C2H2 Zn finger 212..232 CDD:275368
C2H2 Zn finger 240..260 CDD:275368
C2H2 Zn finger 268..288 CDD:275368
C2H2 Zn finger 296..316 CDD:275368
zf-H2C2_2 308..333 CDD:290200 3/14 (21%)
C2H2 Zn finger 324..344 CDD:275368 2/23 (9%)
C2H2 Zn finger 352..372 CDD:275368 7/19 (37%)
C2H2 Zn finger 380..400 CDD:275368 12/21 (57%)
C2H2 Zn finger 408..428 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.