DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and klf15

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_002938279.1 Gene:klf15 / 100495857 XenbaseID:XB-GENE-854149 Length:394 Species:Xenopus tropicalis


Alignment Length:149 Identity:52/149 - (34%)
Similarity:77/149 - (51%) Gaps:13/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PFLSAASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPK 193
            |.|..:|:|.......|....:.....||.|:......::.|::.:           |...:..|
 Frog   244 PQLVQSSNLSSKFVRIAPVPIAAKPVGPGGGIQGQAGVMIGQKFQK-----------NPATELIK 297

  Fly   194 KFKC--PNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCS 256
            ..||  |.|...::.:..||.|:|.||||:||.|....||..|:|::||:||:|.|:|::||.|:
 Frog   298 MHKCTFPGCTKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCA 362

  Fly   257 ACGKKFGRRDHLKKHMKTH 275
            .|.|||.|.|||.||:|.|
 Frog   363 VCEKKFARSDHLSKHIKVH 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 30/67 (45%)
zf-C2H2 195..217 CDD:278523 8/23 (35%)
C2H2 Zn finger 197..217 CDD:275368 7/21 (33%)
zf-H2C2_2 210..236 CDD:290200 14/25 (56%)
C2H2 Zn finger 225..247 CDD:275368 10/21 (48%)
zf-H2C2_2 239..264 CDD:290200 14/24 (58%)
C2H2 Zn finger 255..275 CDD:275368 12/19 (63%)
klf15XP_002938279.1 SFP1 <284..379 CDD:227516 42/105 (40%)
C2H2 Zn finger 301..323 CDD:275368 7/21 (33%)
C2H2 Zn finger 331..353 CDD:275368 10/21 (48%)
zf-H2C2_2 345..370 CDD:372612 14/24 (58%)
C2H2 Zn finger 361..381 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4767
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.