DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and FBXL20

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001357137.1 Gene:FBXL20 / 84961 HGNCID:24679 Length:473 Species:Homo sapiens


Alignment Length:510 Identity:110/510 - (21%)
Similarity:181/510 - (35%) Gaps:167/510 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GSEGSGNSNSPSKRLRNPLAAVTCNNQIDGTASLNFQPSTSRLAQVRQAKKPSTTNITTRIVAAD 218
            |..|.|..|.                   |.|:....|. ||..|.|:...||...:.       
Human     7 GGGGGGGGNR-------------------GGAAAAALPQ-SRHIQKRRKMAPSRDRLL------- 44

  Fly   219 SFFVFRTPAMSAHINSGINYFERLSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLD 283
             .|.|:....|....:.||  ::|..|:||.||.:|...||.|.|.|.|.:|..:.|.:.|.|:|
Human    45 -HFGFKATMFSNSDEAVIN--KKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRID 106

  Fly   284 L--GLRTIRPGALEQIVRR-GVLVIRLAQTSIQEPAFAPYTEVFRTRLQYLDLSMASITRSSLLT 345
            |  ..|.|....:|.|.:| |..:.:|:..                       ....:..::|.|
Human   107 LFDFQRDIEGRVVENISKRCGGFLRKLSLR-----------------------GCLGVGDNALRT 148

  Fly   346 LLSHCRQLKKISLEN-IELDDDICAEIAK-NEALEAVNLTMASGLTSNSVRLMMESLTSLSSLNI 408
            ...:||.::.::|.. .:..|..|..::| ...|..::|...:.:|:.|::.:.|....|..|||
Human   149 FAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNI 213

  Fly   409 SWTD-LSADAVTALV--------------THIS-----------PNLIRLNI------------- 434
            ||.| ::.|.:.|||              |.:.           |.|:.||:             
Human   214 SWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLIT 278

  Fly   435 -------------AGCRRV-------------------------LFDSHVATLQKRCPQLLELDL 461
                         :||..:                         |.|....||.:.|.:|.::||
Human   279 ICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDL 343

  Fly   462 SDCNSLT-PTVITAIMKFKMLEYLSVSRCYLI---------------PATKFIELKSMPSLTYLD 510
            .:|..:| .|:|...:....|:.||:|.|.||               ...:.|||.:.|.:|...
Human   344 EECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDAS 408

  Fly   511 IFGMLSDTAMEVLE----KQLPKMGINKF--------IHSSVS----RPTVGTRR 549
            :..:.|..::|.:|    :|:.:.||.:.        :|:..:    .|:||..|
Human   409 LEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSR 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 17/44 (39%)
leucine-rich repeat 302..327 CDD:275381 1/24 (4%)
AMN1 309..480 CDD:187754 43/250 (17%)
leucine-rich repeat 328..352 CDD:275381 3/23 (13%)
leucine-rich repeat 353..376 CDD:275381 4/24 (17%)
leucine-rich repeat 377..402 CDD:275381 5/24 (21%)
leucine-rich repeat 403..428 CDD:275381 12/50 (24%)
leucine-rich repeat 429..455 CDD:275381 10/76 (13%)
leucine-rich repeat 456..480 CDD:275381 7/24 (29%)
leucine-rich repeat 481..500 CDD:275381 8/33 (24%)
leucine-rich repeat 506..529 CDD:275381 5/26 (19%)
FBXL20NP_001357137.1 F-box-like 64..106 CDD:338561 17/41 (41%)
leucine-rich repeat 102..129 CDD:275381 10/26 (38%)
AMN1 130..326 CDD:355707 33/218 (15%)
leucine-rich repeat 130..149 CDD:275381 2/41 (5%)
leucine-rich repeat 156..181 CDD:275381 4/24 (17%)
leucine-rich repeat 182..207 CDD:275381 5/24 (21%)
leucine-rich repeat 208..233 CDD:275381 11/24 (46%)
leucine-rich repeat 234..259 CDD:275381 1/24 (4%)
AMN1 257..431 CDD:355707 34/173 (20%)
leucine-rich repeat 260..285 CDD:275381 3/24 (13%)
leucine-rich repeat 286..311 CDD:275381 2/24 (8%)
leucine-rich repeat 312..337 CDD:275381 5/24 (21%)
leucine-rich repeat 338..363 CDD:275381 7/24 (29%)
leucine-rich repeat 364..392 CDD:275381 7/27 (26%)
leucine-rich repeat 393..417 CDD:275381 6/23 (26%)
leucine-rich repeat 418..443 CDD:275381 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.