DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and fbxl17

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_001335097.5 Gene:fbxl17 / 795023 ZFINID:ZDB-GENE-111013-3 Length:409 Species:Danio rerio


Alignment Length:235 Identity:54/235 - (22%)
Similarity:92/235 - (39%) Gaps:51/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SSLGSEGSGNSNSPSKRLRNPLAAVTCNNQIDGTASLNFQPSTSRLAQVRQAKK-PSTTNITTRI 214
            ||..|..|....:.:.|..:|..|.||:             |:|...|...::: .||.|..|  
Zfish   169 SSSSSSASEEDGATAGRHSDPGGATTCS-------------SSSCCCQTEASEEIKSTENTDT-- 218

  Fly   215 VAADSFFVFRTPAMSAHINSGINYFERLSDEILLDIFKWLP-KKTLLRMATVCRRFNRCSRDETL 278
                           :|||       :|...|||.:|..|. |:..|..:.||:.:.....|...
Zfish   219 ---------------SHIN-------QLPSSILLKVFSHLSVKERCLAASLVCKYWRDLCLDFQF 261

  Fly   279 WTRLDL-GLRTIRPGALEQIV--RRGVLVIRLAQ-TSIQEPAFAPYTEVFRTRLQYLDLSMASIT 339
            |.::|| ||:.::...|.:|.  |:.|..|.::. .::|:.............::|.......::
Zfish   262 WKQIDLSGLQQVKDDLLVKIASRRQNVTEINISDCRNVQDHGVCALASNCAGLIKYTAYRCKQLS 326

  Fly   340 RSSLLTLLSHCRQLKKISLEN--------IELDDDICAEI 371
            ..||.|:..||..|:|:.:.|        ::|..|.|.|:
Zfish   327 DVSLSTVAIHCPLLQKVHVGNQDKLTDHALKLLGDHCKEL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 12/45 (27%)
leucine-rich repeat 302..327 CDD:275381 3/25 (12%)
AMN1 309..480 CDD:187754 14/72 (19%)
leucine-rich repeat 328..352 CDD:275381 6/23 (26%)
leucine-rich repeat 353..376 CDD:275381 7/27 (26%)
leucine-rich repeat 377..402 CDD:275381
leucine-rich repeat 403..428 CDD:275381
leucine-rich repeat 429..455 CDD:275381
leucine-rich repeat 456..480 CDD:275381
leucine-rich repeat 481..500 CDD:275381
leucine-rich repeat 506..529 CDD:275381
fbxl17XP_001335097.5 F-box-like 221..268 CDD:289689 15/53 (28%)
AMN1 257..>397 CDD:187754 25/110 (23%)
leucine-rich repeat 262..287 CDD:275381 8/24 (33%)
leucine-rich repeat 288..313 CDD:275381 3/24 (13%)
leucine-rich repeat 314..339 CDD:275381 6/24 (25%)
leucine-rich repeat 340..365 CDD:275381 6/24 (25%)
leucine-rich repeat 366..391 CDD:275381 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.