Sequence 1: | NP_730815.2 | Gene: | Skp2 / 40548 | FlyBaseID: | FBgn0037236 | Length: | 559 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005270206.1 | Gene: | FBXL15 / 79176 | HGNCID: | 28155 | Length: | 387 | Species: | Homo sapiens |
Alignment Length: | 258 | Identity: | 66/258 - (25%) |
---|---|---|---|
Similarity: | 107/258 - (41%) | Gaps: | 39/258 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 DEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDL-GLRTIRPGALEQIVRRGVL--VI 305
Fly 306 RLAQTSIQEPAFAPYTE---------VFRTRLQYLDLSM---ASITRSSLLTLLSHCRQLKKISL 358
Fly 359 ENIELDD--------DICAEIAKNEALEAVNLTMASGLTSNS-VRLMMESLTSLSSLNISWTDLS 414
Fly 415 ADAVTALVTHISPNLIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAIMK 477 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Skp2 | NP_730815.2 | F-box-like | 239..284 | CDD:289689 | 10/39 (26%) |
leucine-rich repeat | 302..327 | CDD:275381 | 10/35 (29%) | ||
AMN1 | 309..480 | CDD:187754 | 48/190 (25%) | ||
leucine-rich repeat | 328..352 | CDD:275381 | 5/26 (19%) | ||
leucine-rich repeat | 353..376 | CDD:275381 | 6/30 (20%) | ||
leucine-rich repeat | 377..402 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 403..428 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 429..455 | CDD:275381 | 11/25 (44%) | ||
leucine-rich repeat | 456..480 | CDD:275381 | 4/22 (18%) | ||
leucine-rich repeat | 481..500 | CDD:275381 | |||
leucine-rich repeat | 506..529 | CDD:275381 | |||
FBXL15 | XP_005270206.1 | F-box | 105..>142 | CDD:279040 | 9/35 (26%) |
leucine-rich repeat | 149..175 | CDD:275381 | 6/26 (23%) | ||
leucine-rich repeat | 176..202 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 203..228 | CDD:275381 | 4/24 (17%) | ||
AMN1 | <226..>353 | CDD:187754 | 36/133 (27%) | ||
leucine-rich repeat | 229..254 | CDD:275381 | 6/30 (20%) | ||
leucine-rich repeat | 255..281 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 282..307 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 308..332 | CDD:275381 | 10/24 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165153061 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |