DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and Fbxl20

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_006534361.1 Gene:Fbxl20 / 72194 MGIID:1919444 Length:438 Species:Mus musculus


Alignment Length:443 Identity:98/443 - (22%)
Similarity:165/443 - (37%) Gaps:139/443 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 FVFRTPAMSAHINSGINYFERLSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDL- 284
            |.|:....|....:.||  ::|..|:||.||.:|...||.|.|.|.|.:|..:.|.:.|.|:|| 
Mouse    11 FGFKATMFSNSDEAVIN--KKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLF 73

  Fly   285 -GLRTIRPGALEQIVRR-GVLVIRLAQTSIQEPAFAPYTEVFRTRLQYLDLSMASITRSSLLTLL 347
             ..|.|....:|.|.:| |..:.:|:..                       ....:..::|.|..
Mouse    74 DFQRDIEGRVVENISKRCGGFLRKLSLR-----------------------GCLGVGDNALRTFA 115

  Fly   348 SHCRQLKKISLEN-IELDDDICAEIAK-NEALEAVNLTMASGLTSNSVRLMMESLTSLSSLNISW 410
            .:||.::.:||.. .:..|..|..::| ...|..::|...:.:|:.|::.:.|....|..|||||
Mouse   116 QNCRNIEVLSLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISW 180

  Fly   411 TD-LSADAVTALV--------------THIS-----------PNLIRLNI--------------- 434
            .| ::.|.:.|||              |.:.           |.|:.||:               
Mouse   181 CDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITIC 245

  Fly   435 -----------AGCRRV-------------------------LFDSHVATLQKRCPQLLELDLSD 463
                       :||..:                         |.|....||.:.|.:|.::||.:
Mouse   246 RGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEE 310

  Fly   464 CNSLT-PTVITAIMKFKMLEYLSVSRCYLI---------------PATKFIELKSMPSLTYLDIF 512
            |..:| .|:|...:....|:.||:|.|.||               ...:.|||.:.|.:|...:.
Mouse   311 CVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLE 375

  Fly   513 GMLSDTAMEVLE----KQLPKMGINKF--------IHSSVS----RPTVGTRR 549
            .:.|..::|.:|    :|:.:.||.:.        :|:..:    .|:||..|
Mouse   376 HLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSR 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 17/44 (39%)
leucine-rich repeat 302..327 CDD:275381 1/24 (4%)
AMN1 309..480 CDD:187754 44/250 (18%)
leucine-rich repeat 328..352 CDD:275381 3/23 (13%)
leucine-rich repeat 353..376 CDD:275381 5/24 (21%)
leucine-rich repeat 377..402 CDD:275381 5/24 (21%)
leucine-rich repeat 403..428 CDD:275381 12/50 (24%)
leucine-rich repeat 429..455 CDD:275381 10/76 (13%)
leucine-rich repeat 456..480 CDD:275381 7/24 (29%)
leucine-rich repeat 481..500 CDD:275381 8/33 (24%)
leucine-rich repeat 506..529 CDD:275381 5/26 (19%)
Fbxl20XP_006534361.1 F-box-like 30..71 CDD:403981 17/40 (43%)
leucine-rich repeat 67..94 CDD:275381 10/26 (38%)
AMN1 95..291 CDD:187754 34/218 (16%)
leucine-rich repeat 95..114 CDD:275381 2/41 (5%)
leucine-rich repeat 121..146 CDD:275381 5/24 (21%)
leucine-rich repeat 147..172 CDD:275381 5/24 (21%)
leucine-rich repeat 173..198 CDD:275381 11/24 (46%)
leucine-rich repeat 199..224 CDD:275381 1/24 (4%)
AMN1 222..396 CDD:187754 34/173 (20%)
leucine-rich repeat 225..250 CDD:275381 3/24 (13%)
leucine-rich repeat 251..276 CDD:275381 2/24 (8%)
leucine-rich repeat 277..302 CDD:275381 5/24 (21%)
leucine-rich repeat 303..328 CDD:275381 7/24 (29%)
leucine-rich repeat 329..357 CDD:275381 7/27 (26%)
leucine-rich repeat 358..382 CDD:275381 6/23 (26%)
leucine-rich repeat 383..408 CDD:275381 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.