DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and fbxl5

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_012816107.1 Gene:fbxl5 / 496483 XenbaseID:XB-GENE-968565 Length:662 Species:Xenopus tropicalis


Alignment Length:464 Identity:83/464 - (17%)
Similarity:144/464 - (31%) Gaps:186/464 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLW------------------TRLD----- 283
            |..|::|:||.:|..:.|.|.:.|..::.:.:|..:||                  |.||     
 Frog   208 LPPEVMLNIFSYLNPQDLCRCSQVNTKWAQLARTGSLWRHLYPVLWARGDWYSGPPTHLDNEPDE 272

  Fly   284 --LGLRTIRPGALEQ---------------------------------------IVRRGVLVIRL 307
              :..|.....|.::                                       .:...|..:.|
 Frog   273 DWISRRKDESRAYQEWDEDADIDESEETGEDDPSISVAQREKELLNSLVHYILPYIGHSVKTLVL 337

  Fly   308 AQTSIQEPAFAPYTEVFRTRLQY------LDLSMASITRSSLL-TLLSHCRQLKKISLENIELDD 365
            |.:|      |...:|.|..|:|      |||:...|:.|:.. .....|:.|:.|.|..     
 Frog   338 AYSS------ATSNKVIRQILEYCPNMEHLDLTQTDISDSAFNGWCFGACQTLRHIDLSG----- 391

  Fly   366 DICAEIAKNEALEAVNLTMASGL--------------TSNSVRLMME--SLTSLSSLNISWTDLS 414
              |.:|. :.|||.:::.:...|              |...:|..|.  ||..::..:..::|.|
 Frog   392 --CEKIT-DSALEKLSVALGMPLAHKKRLLKCYRNNRTVKDIRNQMRCGSLAQITGESGIYSDYS 453

  Fly   415 ADAVTAL-----------------------VTHISPNLIRLNIAGCRR--------VLFDSH--- 445
            :..:..|                       |..::|||...:...|.|        |:...|   
 Frog   454 SSQIWILNSGNLGDIEDAADWKFRTTDGLGVLEMTPNLTCFSNGCCSRAVPGRWTNVIRQEHCKA 518

  Fly   446 ---------------------------VATLQKR----CPQLLELDLSDCNSLTPTVITAIMKFK 479
                                       ..|||..    ||...:||....              :
 Frog   519 APLNYCGHTLCGNTLRTIQALPGSNIGTKTLQSEIRDICPGSAKLDQQVA--------------R 569

  Fly   480 MLEYLSVSRCYLIPATKFIELK---SMPSLTYLDIFGMLSDT--AMEVLEKQLPKMGINKFIH-S 538
            :|::||:|.|:.|.......|.   .:|:|.:|::.|.|:.|  .::.|....|.:....|.: .
 Frog   570 VLQFLSLSGCHQITDHGLRVLTIGGGLPNLEHLNLSGCLNVTGSGLQDLVSACPSLNDEHFYYCD 634

  Fly   539 SVSRPTVGT 547
            ::|.|...|
 Frog   635 NISGPHAAT 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 15/66 (23%)
leucine-rich repeat 302..327 CDD:275381 7/24 (29%)
AMN1 309..480 CDD:187754 44/258 (17%)
leucine-rich repeat 328..352 CDD:275381 8/30 (27%)
leucine-rich repeat 353..376 CDD:275381 5/22 (23%)
leucine-rich repeat 377..402 CDD:275381 8/40 (20%)
leucine-rich repeat 403..428 CDD:275381 4/47 (9%)
leucine-rich repeat 429..455 CDD:275381 9/67 (13%)
leucine-rich repeat 456..480 CDD:275381 2/23 (9%)
leucine-rich repeat 481..500 CDD:275381 6/18 (33%)
leucine-rich repeat 506..529 CDD:275381 6/24 (25%)
fbxl5XP_012816107.1 Hr_FBXL5 7..160 CDD:213984
F-box-like 205..249 CDD:372399 12/40 (30%)
leucine-rich repeat 332..357 CDD:275381 9/30 (30%)
AMN1 <340..444 CDD:187754 26/117 (22%)
leucine-rich repeat 358..383 CDD:275381 6/24 (25%)
leucine-rich repeat 384..438 CDD:275381 12/61 (20%)
leucine-rich repeat 439..500 CDD:275381 8/60 (13%)
leucine-rich repeat 511..559 CDD:275381 5/47 (11%)
AMN1 556..>625 CDD:187754 19/82 (23%)
leucine-rich repeat 571..598 CDD:275381 7/26 (27%)
leucine-rich repeat 599..624 CDD:275381 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.