DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and CG5003

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster


Alignment Length:257 Identity:61/257 - (23%)
Similarity:104/257 - (40%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 DEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDLGLRTIRPGALEQIVRRG---VLVI 305
            ||:|.:||::|...::|.:.....||.....|...:..:||....:..|.||:|:.|.   ...|
  Fly    74 DELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDL
SNGPLPMGILEEILGRATEKTHTI 138

  Fly   306 RL-AQTSIQEPA--FAPYTEVFRTRLQYLDLSMASITRSSLLTLLSHCRQLKKISLENIELDDD- 366
            :: ...|.|..|  |..:|:                   :|.::.....|||.:.||.:.||.: 
  Fly   139 KICGPPSSQHVAGEFRQFTQ-------------------TLSSVFPRVVQLKVLELEGVSLDFEY 184

  Fly   367 --ICAEIAKNEALEAVNLTMASGLTSNSVRLMME-SLTSLSSLNI---SWTDLSADAVTALVTHI 425
              |....|....|:..:.::..|.|..|:...:| .|..|..|:|   ||.:      ...:..:
  Fly   185 IHITEFPATLRRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFE------PYYIMGL 243

  Fly   426 S--PNLIRLNIAGCRR----VLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAIMKFKML 481
            |  |:|.||::.||:.    |.:.|..|....:..:.|:|..:..|:......:||...|.|
  Fly   244 SKLPSLRRLSLKGCQALCKFVPYGSMAARFGFQKLESLDLRQTPINNSDLQCFSAIENLKEL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 10/39 (26%)
leucine-rich repeat 302..327 CDD:275381 6/27 (22%)
AMN1 309..480 CDD:187754 41/185 (22%)
leucine-rich repeat 328..352 CDD:275381 1/23 (4%)
leucine-rich repeat 353..376 CDD:275381 8/25 (32%)
leucine-rich repeat 377..402 CDD:275381 6/25 (24%)
leucine-rich repeat 403..428 CDD:275381 6/29 (21%)
leucine-rich repeat 429..455 CDD:275381 8/29 (28%)
leucine-rich repeat 456..480 CDD:275381 5/23 (22%)
leucine-rich repeat 481..500 CDD:275381 1/1 (100%)
leucine-rich repeat 506..529 CDD:275381
CG5003NP_651593.1 F-box 68..114 CDD:279040 10/39 (26%)
leucine-rich repeat 610..635 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.