DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and fbxl2

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_956400.1 Gene:fbxl2 / 378737 ZFINID:ZDB-GENE-030925-12 Length:432 Species:Danio rerio


Alignment Length:347 Identity:79/347 - (22%)
Similarity:155/347 - (44%) Gaps:71/347 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 RTPAMSAHINSGINYFERLSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDL-GLR 287
            |....|.:..:.||  ::|..|:||.||.:|...||.|.|.|.:.:|..:.|.:.|.::|| ..:
Zfish     8 RFEVFSNNDEAPIN--KKLPKELLLRIFSYLDVVTLCRCAQVSKAWNVLALDGSNWQKIDLFNFQ 70

  Fly   288 T-IRPGALEQIVRR--GVLVIRLAQTSIQEPAFAPYTEVFRTRLQYLDLSMASITRSSLLTLLSH 349
            | |....:|.|.:|  |.    |.|.|::                    ...|:..:|:.|...:
Zfish    71 TDIEGRVVENISKRCGGF----LRQLSLR--------------------GCLSVGDASMKTFAQN 111

  Fly   350 CRQLKKISLEN-IELDDDICAEIAK-NEALEAVNLTMASGLTSNSVRLMMESLTSLSSLNISWTD 412
            ||.::.::|.. .::.|..|..::| ...|..::||....:|:::::.:.|....|.:||:||.|
Zfish   112 CRNIEHLNLNGCTKITDSTCISLSKFCFKLRHLDLTSCVSITNHALKALSEGCRMLENLNLSWCD 176

  Fly   413 -LSADAVTAL----------------------VTHIS---PNLIRLNIAGCRRVLFDSHVATLQK 451
             :::|.:.||                      :.|:.   |.|:.:|:..|.::..|..| :|.:
Zfish   177 QITSDGIEALSRGCTALRALFLRGCTQLDDTALKHLQKHCPELMTINMQSCTQITDDGFV-SLCR 240

  Fly   452 RCPQLLELDLSDCNSLTPTVITAI-MKFKMLEYLSVSRC-------YLIPATKFIELKSMPSLTY 508
            .|.:|..:.:|.|:::|...:||: :..:.|:.|..:||       :.:.|....|::.|.    
Zfish   241 GCHKLQMVCISGCSNITDASLTALGLNCQRLKILEAARCSHVTDAGFTVLARNCHEMEKMD---- 301

  Fly   509 LDIFGMLSDTAMEVLEKQLPKM 530
            |:...:::|..:..|....|::
Zfish   302 LEECILVTDNTLVQLSIHCPRL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 15/44 (34%)
leucine-rich repeat 302..327 CDD:275381 3/24 (13%)
AMN1 309..480 CDD:187754 40/199 (20%)
leucine-rich repeat 328..352 CDD:275381 4/23 (17%)
leucine-rich repeat 353..376 CDD:275381 4/24 (17%)
leucine-rich repeat 377..402 CDD:275381 5/24 (21%)
leucine-rich repeat 403..428 CDD:275381 10/50 (20%)
leucine-rich repeat 429..455 CDD:275381 7/25 (28%)
leucine-rich repeat 456..480 CDD:275381 6/24 (25%)
leucine-rich repeat 481..500 CDD:275381 5/25 (20%)
leucine-rich repeat 506..529 CDD:275381 3/22 (14%)
fbxl2NP_956400.1 F-box-like 24..66 CDD:289689 15/41 (37%)
leucine-rich repeat 61..88 CDD:275381 8/26 (31%)
AMN1 63..284 CDD:187754 53/245 (22%)
leucine-rich repeat 89..108 CDD:275381 5/38 (13%)
leucine-rich repeat 115..140 CDD:275381 4/24 (17%)
leucine-rich repeat 141..166 CDD:275381 5/24 (21%)
leucine-rich repeat 167..192 CDD:275381 9/24 (38%)
leucine-rich repeat 193..218 CDD:275381 1/24 (4%)
AMN1 212..390 CDD:187754 25/117 (21%)
leucine-rich repeat 219..244 CDD:275381 7/25 (28%)
leucine-rich repeat 245..270 CDD:275381 6/24 (25%)
leucine-rich repeat 271..296 CDD:275381 5/24 (21%)
leucine-rich repeat 297..322 CDD:275381 4/28 (14%)
leucine-rich repeat 323..351 CDD:275381 0/1 (0%)
leucine-rich repeat 352..376 CDD:275381
leucine-rich repeat 377..402 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.