DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and Fbxl2

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_038938600.1 Gene:Fbxl2 / 363156 RGDID:1562243 Length:439 Species:Rattus norvegicus


Alignment Length:347 Identity:79/347 - (22%)
Similarity:147/347 - (42%) Gaps:68/347 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 IFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDL-GLRT-IRPGALEQIVRR-GVLVIRLAQTS 311
            ||.:|...||.|.|.:.:.:|..:.|.:.|.|:|| ..:| :....:|.|.:| |..:.:|:.. 
  Rat    39 IFSFLDIVTLCRCAQISKAWNILALDGSNWQRVDLFNFQTDVEGRVVENISKRCGGFLRKLSLR- 102

  Fly   312 IQEPAFAPYTEVFRTRLQYLDLSMASITRSSLLTLLSHCRQLKKISLEN-IELDDDICAEIAK-N 374
                                  ....:..|||.|...:||.::.::|.. .::.|..|..::: .
  Rat   103 ----------------------GCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFC 145

  Fly   375 EALEAVNLTMASGLTSNSVRLMMESLTSLSSLNISWTD-LSADAVTALV---------------- 422
            ..|:.::||....:|::|::.:.|...:|..||:||.| ::.:.:.|||                
  Rat   146 SKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQ 210

  Fly   423 ------THISPN---LIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAI-MK 477
                  .||..:   |:.||:..|.|:. |..|..:.:.|.:|..|.||.|::||...:||: :.
  Rat   211 LEDEALKHIQNHCHELVSLNLQSCSRIT-DDGVVQICRGCHRLQALCLSGCSNLTDASLTALGLN 274

  Fly   478 FKMLEYLSVSRC-YLIPATKFIELKSMPSLTYLDI--FGMLSDTAMEVLEKQLPKMGINKFIHSS 539
            ...|:.|..:|| :|..|...:..::...|..:|:  ..:::|:.:..|....||:......|..
  Rat   275 CPRLQVLEAARCSHLTDAGFTLLARNCHDLEKMDLEECVLITDSTLIQLSIHCPKLQALSLSHCE 339

  Fly   540 ---------VSRPTVGTRRTSI 552
                     :|..|.|..|..:
  Rat   340 LITDEGILHLSSSTCGHERLRV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 11/33 (33%)
leucine-rich repeat 302..327 CDD:275381 1/24 (4%)
AMN1 309..480 CDD:187754 43/199 (22%)
leucine-rich repeat 328..352 CDD:275381 5/23 (22%)
leucine-rich repeat 353..376 CDD:275381 3/24 (13%)
leucine-rich repeat 377..402 CDD:275381 6/24 (25%)
leucine-rich repeat 403..428 CDD:275381 11/47 (23%)
leucine-rich repeat 429..455 CDD:275381 8/25 (32%)
leucine-rich repeat 456..480 CDD:275381 9/24 (38%)
leucine-rich repeat 481..500 CDD:275381 6/19 (32%)
leucine-rich repeat 506..529 CDD:275381 4/24 (17%)
Fbxl2XP_038938600.1 F-box-like <38..72 CDD:403981 11/32 (34%)
leucine-rich repeat 68..95 CDD:275381 9/26 (35%)
AMN1 <92..239 CDD:187754 33/170 (19%)
leucine-rich repeat 96..115 CDD:275381 4/41 (10%)
leucine-rich repeat 122..147 CDD:275381 3/24 (13%)
leucine-rich repeat 148..173 CDD:275381 6/24 (25%)
leucine-rich repeat 174..199 CDD:275381 9/24 (38%)
AMN1 184..383 CDD:187754 39/179 (22%)
leucine-rich repeat 200..225 CDD:275381 2/24 (8%)
leucine-rich repeat 226..251 CDD:275381 8/25 (32%)
leucine-rich repeat 252..277 CDD:275381 9/24 (38%)
leucine-rich repeat 278..303 CDD:275381 6/24 (25%)
leucine-rich repeat 304..329 CDD:275381 4/24 (17%)
leucine-rich repeat 330..352 CDD:275381 2/21 (10%)
leucine-rich repeat 359..378 CDD:275381 0/3 (0%)
leucine-rich repeat 384..409 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.