DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and CG8272

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001260812.1 Gene:CG8272 / 35875 FlyBaseID:FBgn0033337 Length:710 Species:Drosophila melanogaster


Alignment Length:577 Identity:114/577 - (19%)
Similarity:190/577 - (32%) Gaps:197/577 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SNETTPCASVSRMAHQLQH--TQRLSLGSTGDI------TLDSPAVEDSLSMSRQSAEKLQILAQ 147
            |::.:|...:.|...:.||  .:.::||...::      |..|.|:::.....:|....|.:|..
  Fly    64 SDQLSPGVDLMRCERRFQHFLFEDVTLGQVKELMRFMGRTAQSLALDNVDLNDKQFYGMLGVLPH 128

  Fly   148 AKRSSL---------GS--EGSGNSNSPSKRLRNPLAAV----TCNNQIDGTASL----NFQPST 193
            ....||         ||  :...||......|.:.||.:    .|.||....|.|    :|.||.
  Fly   129 LHSLSLKRCLPLFMSGSFLDSYNNSCPDLNDLASNLAGIKELTLCENQYLTDAILMRLTSFMPSL 193

  Fly   194 SRLAQ----------VRQAKKPSTTNITTRIVAADSFFVFRTPAMSAHINSG----INYFERLSD 244
            ..:..          :.:...|:|:: :..::.::|...|:......::...    :|:...|..
  Fly   194 EAINMSGCHIAFHNAIHRRFYPATSS-SDHVLPSESVLTFKFILTILNLQRRTLRVLNFSHTLIG 257

  Fly   245 EILLDIFKWLPKKTLLRMATVCRRFN----------------------RCSRDETLWTRLDLGLR 287
            :.||.:.....:...|.:|. ||:.|                      .|..||.|     ..|.
  Fly   258 QALLALCDLNLQLQRLYLAG-CRQLNCTTILNFLATQPQLCALDLSATMCVNDENL-----AALV 316

  Fly   288 TIRPGALEQIVRRGVLVI-----------------------RLAQTSIQEPAFAPYTEVFRTRLQ 329
            ...| .||.:...|.|.|                       .|..:.|.|...:....|    :|
  Fly   317 QTNP-QLEHLKVNGCLSITNAGAIHLAKLKCLKSLDISNCDNLTSSGIIEGIASEENPV----IQ 376

  Fly   330 YLDLSMASITRSSLLTLLSHCRQLKKISLENIELDDDICAEIAKNEALEAV----------NLTM 384
            .|::|...|....:..:.|:.|.|:.:.|.:       |...|.:||:::|          :|..
  Fly   377 ELNVSYLQICEECIKAIASNLRCLRSLHLNH-------CVNGATDEAIQSVIGQLRWLRELSLEH 434

  Fly   385 ASGLTS------NSVRLMM--------------------------ESLT-SLSSLNISWTDLSAD 416
            .||||.      |..:|.|                          :||. ||.|:.||....:.|
  Fly   435 CSGLTDAALTGINISKLEMSRKQSGSQVSSMDNFYPPYSNTLAERDSLAGSLQSIKISLRSKAED 499

  Fly   417 AVT-------ALVTHISPNLIR-----------------LNIAGC-----------------RRV 440
            .:.       |::.....||||                 ||:.||                 ||:
  Fly   500 EIVRDARRKQAMLAAYEMNLIREDDFEGHNIQQLRGLRSLNLRGCNKISDVSLKYGLKHIELRRL 564

  Fly   441 LFDS-------HVATLQKRCPQLLELDLSDCNSLTPTVITAI-MKFKMLEYLSVSRC 489
            :..:       .:..:...||.:.|||||||.::|...|..: .|...|:.|.:|.|
  Fly   565 MLSNCQQISLLGMEAMASSCPSIEELDLSDCYNITDKTIQVVTSKLPRLKALHISGC 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 12/66 (18%)
leucine-rich repeat 302..327 CDD:275381 6/47 (13%)
AMN1 309..480 CDD:187754 55/262 (21%)
leucine-rich repeat 328..352 CDD:275381 5/23 (22%)
leucine-rich repeat 353..376 CDD:275381 4/22 (18%)
leucine-rich repeat 377..402 CDD:275381 11/67 (16%)
leucine-rich repeat 403..428 CDD:275381 6/31 (19%)
leucine-rich repeat 429..455 CDD:275381 10/66 (15%)
leucine-rich repeat 456..480 CDD:275381 10/24 (42%)
leucine-rich repeat 481..500 CDD:275381 4/9 (44%)
leucine-rich repeat 506..529 CDD:275381
CG8272NP_001260812.1 AMN1 269..440 CDD:187754 37/188 (20%)
leucine-rich repeat 270..295 CDD:275381 5/25 (20%)
leucine-rich repeat 296..319 CDD:275381 5/27 (19%)
leucine-rich repeat 322..346 CDD:275381 5/23 (22%)
leucine-rich repeat 347..399 CDD:275381 9/55 (16%)
leucine-rich repeat 400..426 CDD:275381 7/32 (22%)
leucine-rich repeat 427..535 CDD:275381 21/107 (20%)
AMN1 515..>642 CDD:187754 26/107 (24%)
leucine-rich repeat 536..560 CDD:275381 4/23 (17%)
leucine-rich repeat 561..586 CDD:275381 3/24 (13%)
leucine-rich repeat 587..612 CDD:275381 10/24 (42%)
leucine-rich repeat 613..638 CDD:275381 4/9 (44%)
leucine-rich repeat 639..663 CDD:275381
F-box-like 12..>44 CDD:289689
leucine-rich repeat 129..166 CDD:275381 8/36 (22%)
leucine-rich repeat 167..192 CDD:275381 6/24 (25%)
leucine-rich repeat 193..244 CDD:275381 4/51 (8%)
C2 <231..274 CDD:301316 5/42 (12%)
leucine-rich repeat 246..269 CDD:275381 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.