| Sequence 1: | NP_730815.2 | Gene: | Skp2 / 40548 | FlyBaseID: | FBgn0037236 | Length: | 559 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_610051.2 | Gene: | CG9316 / 35333 | FlyBaseID: | FBgn0032878 | Length: | 448 | Species: | Drosophila melanogaster |
| Alignment Length: | 372 | Identity: | 65/372 - (17%) |
|---|---|---|---|
| Similarity: | 124/372 - (33%) | Gaps: | 148/372 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 242 LSDEILLDIFKWLPK---KTLLRMATVCRRFNRCSRDETLWTRLD---LGLRTIRPGALEQIVR- 299
Fly 300 ---RG--VLVIRLAQTSIQ-EPAFAPYTEVFRTRLQYLDLSMAS--ITRSSLLTLLSHCRQLKKI 356
Fly 357 SLENIELDDDICAEIAKNEALEAVNL--------------------------------------- 382
Fly 383 ----------------------------------------------------TMASGLTSNSVRL 395
Fly 396 -------------------------------MMESLTSLSSLNISWTDLSADAVTALVTHISPNL 429
Fly 430 IRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLTPT-VITAI 475 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Skp2 | NP_730815.2 | F-box-like | 239..284 | CDD:289689 | 12/47 (26%) |
| leucine-rich repeat | 302..327 | CDD:275381 | 4/25 (16%) | ||
| AMN1 | 309..480 | CDD:187754 | 47/293 (16%) | ||
| leucine-rich repeat | 328..352 | CDD:275381 | 5/25 (20%) | ||
| leucine-rich repeat | 353..376 | CDD:275381 | 5/22 (23%) | ||
| leucine-rich repeat | 377..402 | CDD:275381 | 8/146 (5%) | ||
| leucine-rich repeat | 403..428 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 429..455 | CDD:275381 | 7/25 (28%) | ||
| leucine-rich repeat | 456..480 | CDD:275381 | 10/21 (48%) | ||
| leucine-rich repeat | 481..500 | CDD:275381 | |||
| leucine-rich repeat | 506..529 | CDD:275381 | |||
| CG9316 | NP_610051.2 | leucine-rich repeat | 208..221 | CDD:275381 | 0/12 (0%) |
| leucine-rich repeat | 231..258 | CDD:275381 | 0/26 (0%) | ||
| leucine-rich repeat | 259..279 | CDD:275381 | 0/19 (0%) | ||
| leucine-rich repeat | 280..309 | CDD:275381 | 4/28 (14%) | ||
| AMN1 | 310..>411 | CDD:187754 | 27/99 (27%) | ||
| leucine-rich repeat | 310..334 | CDD:275381 | 1/23 (4%) | ||
| leucine-rich repeat | 335..359 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 360..385 | CDD:275381 | 7/25 (28%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45457957 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||