DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and CG15056

DIOPT Version :10

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster


Alignment Length:337 Identity:70/337 - (20%)
Similarity:132/337 - (39%) Gaps:95/337 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 DEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDLGLRTIRPGALEQIVRRGV----LV 304
            |...||:.|.|..|:.:..|..|..|      |.::.| ...||..|...||:::...:    |.
  Fly    13 DFFWLDVLKQLDLKSRISFAASCDMF------ENIYVR-SSPLRLSRVVNLEEMIEFSLLETKLF 70

  Fly   305 IRLAQTSIQEPAFAPYTEVFRTRLQYLDLSMASITRSSLLTLLSHCRQLKKISLENIELDDDICA 369
            :.|:.:.|:.....|:|.:|.....::.|....:|:            :.:|:||..:|     .
  Fly    71 VELSGSDIEIIRGGPHTPMFSHFEDFIRLMSIRLTK------------VNEIALEGFQL-----T 118

  Fly   370 EIAKNEALEAVNLTMASGLTSNSVR---------LMMESLTSLSSLNISWTD-LSADAVTALVTH 424
            :.....|.|    |..|.||..|:|         :..|.||.|.:|::.:.| |:...:.:|.| 
  Fly   119 QYKWFNAPE----TSFSNLTYVSLRRCQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLPT- 178

  Fly   425 ISPNLIRLNIAGCR-----RVLFDSHVATLQK--------------------RCPQLLELDLSDC 464
               :|:.|.|.|||     :::|.:.:..|::                    .||.|:.:::|.|
  Fly   179 ---SLLSLYITGCRNLCPNQLIFLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVMVEISIC 240

  Fly   465 N------------SLTPTVI----TAIMKFKMLEYLSVSRCYLIPATKFIELKSMPSLTYLDIFG 513
            :            .|...||    |..::.|:.:::.:| ...:|..:.:.....||       |
  Fly   241 SLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLIS-LLDVPFLRNLMFSDAPS-------G 297

  Fly   514 MLSDTAMEVLEK 525
            .:|..|:.::.:
  Fly   298 FVSANALSIISR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box_DmSKP2-like 239..281 CDD:438920 10/36 (28%)
leucine-rich repeat 302..327 CDD:275381 6/28 (21%)
AMN1 309..480 CDD:187754 44/221 (20%)
leucine-rich repeat 328..352 CDD:275381 2/23 (9%)
leucine-rich repeat 353..376 CDD:275381 4/22 (18%)
leucine-rich repeat 377..402 CDD:275381 9/33 (27%)
leucine-rich repeat 403..428 CDD:275381 6/25 (24%)
leucine-rich repeat 429..455 CDD:275381 9/50 (18%)
leucine-rich repeat 456..480 CDD:275381 7/39 (18%)
leucine-rich repeat 481..500 CDD:275381 2/18 (11%)
leucine-rich repeat 506..529 CDD:275381 3/20 (15%)
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 6/22 (27%)
leucine-rich repeat 157..179 CDD:275381 6/25 (24%)
leucine-rich repeat 180..204 CDD:275381 7/23 (30%)
leucine-rich repeat 205..231 CDD:275381 2/25 (8%)
leucine-rich repeat 232..285 CDD:275381 9/53 (17%)
leucine-rich repeat 286..326 CDD:275381 5/31 (16%)
AMN1 306..>376 CDD:187754 0/4 (0%)
leucine-rich repeat 337..362 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.