DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and Fbxl13

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_011248071.1 Gene:Fbxl13 / 320118 MGIID:2443416 Length:889 Species:Mus musculus


Alignment Length:394 Identity:84/394 - (21%)
Similarity:156/394 - (39%) Gaps:118/394 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDLG-LRTIRPGALEQIVRRGVL-V 304
            |.::.:|.||.:|..|.::..:.|.|.:....:..:||..:|.. ::.|....:...:::..| |
Mouse   243 LPEQAILQIFLYLTFKDMMACSRVNRSWMAMIQRGSLWNSIDFSTVKNIADKCVVTTLQKWRLNV 307

  Fly   305 IRLAQTSIQEPAFAPYTEVFRTR----------LQ--------------------------YLDL 333
            :||......          |||:          ||                          ||:|
Mouse   308 LRLNFRGCD----------FRTKTLKAVSHCKNLQELNVSDCQSFTDESMRHISEGCPGVLYLNL 362

  Fly   334 SMASITRSSLLTL-----------LSHCRQ-----LKKISLEN-----IELDDDICAEIA----K 373
            |..:||..::..|           |::||:     |:.::|.|     |.||...|.:|:    :
Mouse   363 SNTTITNRTMRLLPRYFHNLQNLSLAYCRKFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFR 427

  Fly   374 NEALEA---VNLTM--ASGLTSNSVRLMMESLTSLSS-LNISWTDLSADAVTALVTHISPNLIRL 432
            |.|...   |:||:  ...||.|.|::::|....:|| :.|....:|..|..||   .|.:|.::
Mouse   428 NIASSCTGIVHLTINDMPTLTDNCVKVLVEKCPRISSVVLIGSPHISDSAFKAL---SSCDLKKI 489

  Fly   433 NIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAIMKFKMLEYLSVSRCYLI----- 492
            ...|.:|: .|:...::.:..|.:..:.:.||..||.:.:.::...|.|..|:::.|..|     
Mouse   490 RFEGNKRI-SDACFKSIDRNYPGINHIYMVDCKGLTDSSLKSLSLLKQLTVLNLTNCIRIGDIGL 553

  Fly   493 ------PATKFIELKSM--------------------PSLTYLDIFGM--LSDTAMEVLEKQLPK 529
                  ||:  |.|:.:                    |:|.||::...  |:|.|:|.:...|..
Mouse   554 KHFFDGPAS--IRLRELNLTNCSLLGDSSVIRLSERCPNLHYLNLRNCEHLTDLAIEYIASMLSL 616

  Fly   530 MGIN 533
            :.::
Mouse   617 ISVD 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 10/41 (24%)
leucine-rich repeat 302..327 CDD:275381 6/25 (24%)
AMN1 309..480 CDD:187754 50/237 (21%)
leucine-rich repeat 328..352 CDD:275381 11/60 (18%)
leucine-rich repeat 353..376 CDD:275381 9/31 (29%)
leucine-rich repeat 377..402 CDD:275381 8/29 (28%)
leucine-rich repeat 403..428 CDD:275381 8/25 (32%)
leucine-rich repeat 429..455 CDD:275381 4/25 (16%)
leucine-rich repeat 456..480 CDD:275381 4/23 (17%)
leucine-rich repeat 481..500 CDD:275381 7/29 (24%)
leucine-rich repeat 506..529 CDD:275381 8/24 (33%)
Fbxl13XP_011248071.1 F-box-like 240..284 CDD:372399 10/40 (25%)
leucine-rich repeat 255..268 CDD:275381 3/12 (25%)
leucine-rich repeat 280..306 CDD:275381 3/25 (12%)
AMN1 306..475 CDD:187754 39/178 (22%)
leucine-rich repeat 307..330 CDD:275381 6/32 (19%)
leucine-rich repeat 331..356 CDD:275381 2/24 (8%)
leucine-rich repeat 357..381 CDD:275381 7/23 (30%)
leucine-rich repeat 382..409 CDD:275381 6/26 (23%)
leucine-rich repeat 410..435 CDD:275381 7/24 (29%)
leucine-rich repeat 436..461 CDD:275381 8/24 (33%)
leucine-rich repeat 462..484 CDD:275381 7/24 (29%)
AMN1 473..605 CDD:187754 28/137 (20%)
leucine-rich repeat 486..511 CDD:275381 4/25 (16%)
leucine-rich repeat 512..536 CDD:275381 4/23 (17%)
leucine-rich repeat 537..564 CDD:275381 6/28 (21%)
leucine-rich repeat 565..590 CDD:275381 1/24 (4%)
leucine-rich repeat 591..610 CDD:275381 7/18 (39%)
leucine-rich repeat 617..645 CDD:275381 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.