Sequence 1: | NP_730815.2 | Gene: | Skp2 / 40548 | FlyBaseID: | FBgn0037236 | Length: | 559 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101073.1 | Gene: | Fbxl15 / 309453 | RGDID: | 1306444 | Length: | 300 | Species: | Rattus norvegicus |
Alignment Length: | 260 | Identity: | 68/260 - (26%) |
---|---|---|---|
Similarity: | 107/260 - (41%) | Gaps: | 43/260 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 DEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDLGLRTIRPGALEQI---VRRGVLV- 304
Fly 305 -IRLAQTSIQEPAFAPYTE---------VFRTRLQYLDLSMA---SITRSSLLTLLSHCRQLKKI 356
Fly 357 SLENIELDD--------DICAEIAKNEALEAVNLTMASGLTSNS-VRLMMESLTSLSSLNISWTD 412
Fly 413 LSADAVTALVTHISPNLIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAIMK 477
Fly 478 477 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Skp2 | NP_730815.2 | F-box-like | 239..284 | CDD:289689 | 10/39 (26%) |
leucine-rich repeat | 302..327 | CDD:275381 | 11/35 (31%) | ||
AMN1 | 309..480 | CDD:187754 | 49/190 (26%) | ||
leucine-rich repeat | 328..352 | CDD:275381 | 6/26 (23%) | ||
leucine-rich repeat | 353..376 | CDD:275381 | 7/30 (23%) | ||
leucine-rich repeat | 377..402 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 403..428 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 429..455 | CDD:275381 | 11/25 (44%) | ||
leucine-rich repeat | 456..480 | CDD:275381 | 4/22 (18%) | ||
leucine-rich repeat | 481..500 | CDD:275381 | |||
leucine-rich repeat | 506..529 | CDD:275381 | |||
Fbxl15 | NP_001101073.1 | F-box | 18..55 | CDD:395521 | 10/37 (27%) |
leucine-rich repeat | 62..88 | CDD:275381 | 7/26 (27%) | ||
leucine-rich repeat | 89..115 | CDD:275381 | 7/25 (28%) | ||
Interaction with SMURF1. /evidence=ECO:0000250 | 113..269 | 42/163 (26%) | |||
leucine-rich repeat | 116..141 | CDD:275381 | 5/24 (21%) | ||
AMN1 | <139..>268 | CDD:187754 | 36/135 (27%) | ||
leucine-rich repeat | 142..167 | CDD:275381 | 7/30 (23%) | ||
leucine-rich repeat | 168..194 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 195..220 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 221..245 | CDD:275381 | 10/24 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166346666 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |