Sequence 1: | NP_730815.2 | Gene: | Skp2 / 40548 | FlyBaseID: | FBgn0037236 | Length: | 559 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038937.2 | Gene: | Fbxl6 / 30840 | MGIID: | 1354705 | Length: | 535 | Species: | Mus musculus |
Alignment Length: | 362 | Identity: | 74/362 - (20%) |
---|---|---|---|
Similarity: | 131/362 - (36%) | Gaps: | 110/362 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 226 PAMSAHINSGINYFERLSDEILLDIFKWL-----PKKTLLRMATVCRRFNRCSRDETLWTRLDLG 285
Fly 286 ---------------------LRTIRPGALEQIVRRGVLVIRLAQTSIQEPAFAPYTEVFRTRLQ 329
Fly 330 YLDLS-MASITRSSLLTLLSHCRQLKKISLENIELDDDICAEIAKNEALEAVNLTMASGLTSNSV 393
Fly 394 RLMMESLTSLSSLNISWTDLSADAVTALVTHISPNLIRLNIA---GCRRVLFDSHVATLQKRCPQ 455
Fly 456 LLELDL------------------------------SDCNSLTPTVITAIM----KFKMLEYLSV 486
Fly 487 SR------CYLIPATKFIELKSMPSLTYLDIFGMLSD 517 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Skp2 | NP_730815.2 | F-box-like | 239..284 | CDD:289689 | 15/49 (31%) |
leucine-rich repeat | 302..327 | CDD:275381 | 3/24 (13%) | ||
AMN1 | 309..480 | CDD:187754 | 39/208 (19%) | ||
leucine-rich repeat | 328..352 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 353..376 | CDD:275381 | 2/22 (9%) | ||
leucine-rich repeat | 377..402 | CDD:275381 | 2/24 (8%) | ||
leucine-rich repeat | 403..428 | CDD:275381 | 3/24 (13%) | ||
leucine-rich repeat | 429..455 | CDD:275381 | 8/28 (29%) | ||
leucine-rich repeat | 456..480 | CDD:275381 | 8/57 (14%) | ||
leucine-rich repeat | 481..500 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 506..529 | CDD:275381 | 5/12 (42%) | ||
Fbxl6 | NP_038937.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..25 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 61..99 | 1/5 (20%) | |||
F-box-like | 105..155 | CDD:289689 | 15/49 (31%) | ||
LRR 1 | 169..195 | 4/30 (13%) | |||
AMN1 | 171..390 | CDD:187754 | 46/247 (19%) | ||
leucine-rich repeat | 188..213 | CDD:275381 | 3/29 (10%) | ||
LRR 2 | 196..221 | 6/24 (25%) | |||
leucine-rich repeat | 214..239 | CDD:275381 | 8/24 (33%) | ||
LRR 3 | 222..247 | 7/24 (29%) | |||
leucine-rich repeat | 240..291 | CDD:275381 | 8/74 (11%) | ||
LRR 4 | 273..299 | 5/25 (20%) | |||
leucine-rich repeat | 292..321 | CDD:275381 | 8/28 (29%) | ||
LRR 5 | 304..329 | 10/24 (42%) | |||
leucine-rich repeat | 322..349 | CDD:275381 | 3/26 (12%) | ||
LRR 6 | 330..357 | 0/26 (0%) | |||
AMN1 | <349..500 | CDD:187754 | 17/75 (23%) | ||
leucine-rich repeat | 350..377 | CDD:275381 | 4/26 (15%) | ||
LRR 7 | 360..385 | 6/24 (25%) | |||
leucine-rich repeat | 378..401 | CDD:275381 | 6/23 (26%) | ||
LRR 8 | 386..411 | 7/32 (22%) | |||
LRR 9 | 415..441 | 74/362 (20%) | |||
leucine-rich repeat | 434..466 | CDD:275381 | |||
leucine-rich repeat | 467..491 | CDD:275381 | |||
LRR 10 | 474..499 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167843075 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR16134 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |