DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and Fbxl3

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001094038.1 Gene:Fbxl3 / 306129 RGDID:1305660 Length:428 Species:Rattus norvegicus


Alignment Length:306 Identity:63/306 - (20%)
Similarity:116/306 - (37%) Gaps:70/306 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDLG--------LRTIRPGALEQIV 298
            |..:|:|.:||:||.......:.|||.:|:......||...:..        |:...|..::||:
  Rat    39 LLQDIVLHVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQII 103

  Fly   299 RRGVLVIRLAQTSIQEPAFAPYTEVFRTRLQYLDLSMASITRSS-----LLTLLSHCRQLKKISL 358
            :|                       ....|||:...:.|...|:     :|:.|.:| .||.:.|
  Rat   104 KR-----------------------HSNHLQYVSFKVDSSKESAEAACDILSQLVNC-SLKTLGL 144

  Fly   359 ENIELDDDICAEIAKNEALEAVNLTMASGLTSNSVRLMMESLTSLSSLNISWTDLSADAVTALVT 423
              |........::.|:..:.|:.:...:.             .|||||.|..|.:...::..||.
  Rat   145 --ISTARPSFMDLPKSHFISALTVVFVNS-------------KSLSSLKIDDTPVDDPSLKVLVA 194

  Fly   424 HISPNLIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAIM--KFKMLEYLSV 486
            :.|..|..|.::.|..| ..:.:..:..:|..|.||.| :.:.|:..::.|:.  |...||:|.:
  Rat   195 NNSDTLKLLKMSSCPHV-SPAGILCVADQCHGLRELAL-NYHLLSDELLLALSSEKHVRLEHLRI 257

  Fly   487 SRCYLIPATKFIELKSMPSLTYLDIFGMLSDTAMEVLEKQLPKMGI 532
            .           .:...|..|:   |..:..::.:...|..||:.:
  Rat   258 D-----------VVSENPGQTH---FHTIQKSSWDAFIKHSPKVNL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 13/41 (32%)
leucine-rich repeat 302..327 CDD:275381 0/24 (0%)
AMN1 309..480 CDD:187754 36/177 (20%)
leucine-rich repeat 328..352 CDD:275381 8/28 (29%)
leucine-rich repeat 353..376 CDD:275381 5/22 (23%)
leucine-rich repeat 377..402 CDD:275381 1/24 (4%)
leucine-rich repeat 403..428 CDD:275381 9/24 (38%)
leucine-rich repeat 429..455 CDD:275381 5/25 (20%)
leucine-rich repeat 456..480 CDD:275381 7/25 (28%)
leucine-rich repeat 481..500 CDD:275381 3/18 (17%)
leucine-rich repeat 506..529 CDD:275381 3/22 (14%)
Fbxl3NP_001094038.1 F-box-like 36..77 CDD:403981 12/37 (32%)
leucine-rich repeat 174..199 CDD:275381 9/24 (38%)
leucine-rich repeat 200..225 CDD:275381 5/25 (20%)
leucine-rich repeat 252..286 CDD:275381 7/47 (15%)
leucine-rich repeat 287..333 CDD:275381 0/3 (0%)
leucine-rich repeat 334..360 CDD:275381
leucine-rich repeat 361..383 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.