DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and Skp2

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001099886.1 Gene:Skp2 / 294790 RGDID:1562456 Length:423 Species:Rattus norvegicus


Alignment Length:448 Identity:140/448 - (31%)
Similarity:232/448 - (51%) Gaps:49/448 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DITLDSPAVEDSLSMSRQSAEKLQILAQAKRSSLGSEGSGNSNSPSKRLRN---PLAAVTCNNQI 181
            :|...|..|..|.:....|::..::|:....|:|..|...:.|.|...|.|   |.:        
  Rat     8 EIPDQSSNVTTSFTWGWDSSKTSELLSGMGVSALEKEEVDSENIPHGLLSNLGHPQS-------- 64

  Fly   182 DGTASLNFQPSTSRLAQVRQAKKPSTTNITTRIVAADSFFVFRTPAMSAHINSGINYFERLSDEI 246
                     |...||......|               .|.:.|.|.::.....|::: :.|.||:
  Rat    65 ---------PPRKRLKSKGSDK---------------DFVIIRRPKLNRENFPGVSW-DSLPDEL 104

  Fly   247 LLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDLGLRTIRPGALEQIVRRGVLVIRLAQTS 311
            ||.||..|....|||::.||:|:.|.|.||:||..|||..:.:.|....:::.|||:..|..::.
  Rat   105 LLGIFSCLCLPELLRVSGVCKRWYRLSLDESLWQSLDLAGKNLHPDVTVRLLSRGVVAFRCPRSF 169

  Fly   312 IQEP---AFAPYTEVFRTRLQYLDLSMASITRSSLLTLLSHCRQLKKISLENIELDDDICAEIAK 373
            :::|   :|:.:      |:|::|||.:.|..|:|..:||.|.:|:.:|||.::|.|.|...:|:
  Rat   170 MEQPLGESFSSF------RVQHMDLSNSVINVSNLHGILSECSKLQNLSLEGLQLSDPIVTTLAQ 228

  Fly   374 NEALEAVNLTMASGLTSNSVRLMMESLTSLSSLNISWT-DLSADAVTALVTHISPNLIRLNIAGC 437
            ||.|..:||...||.:.::|..::.|.:.|..||:||. |.:...|.|.|.|:...|.:||::|.
  Rat   229 NENLVRLNLCGCSGFSESAVATLLSSCSRLDELNLSWCFDFTEKHVQAAVAHLPDTLTQLNLSGY 293

  Fly   438 RRVLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAIMKFKMLEYLSVSRCY-LIPATKFIELK 501
            |:.|..:.:.||.||||.|:.|||||...|.........:...|::||:|||| :||.| .:||.
  Rat   294 RKNLQKTDLCTLIKRCPNLVRLDLSDSIMLKNDCFPEFFQLNYLQHLSLSRCYDIIPET-LLELG 357

  Fly   502 SMPSLTYLDIFGMLSDTAMEVLEKQLPKMGINKFIHSSVSRPTVGTRRT-SIWGLRTR 558
            .:|:|..|.:||::.|..:::|.:.||::.||....:|::|||:..::. .|||::.|
  Rat   358 EIPTLKTLQVFGIVPDGTLQLLREALPRLQINCAYFTSIARPTMDNKKNPEIWGIKCR 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 21/44 (48%)
leucine-rich repeat 302..327 CDD:275381 4/27 (15%)
AMN1 309..480 CDD:187754 59/174 (34%)
leucine-rich repeat 328..352 CDD:275381 10/23 (43%)
leucine-rich repeat 353..376 CDD:275381 9/22 (41%)
leucine-rich repeat 377..402 CDD:275381 7/24 (29%)
leucine-rich repeat 403..428 CDD:275381 10/25 (40%)
leucine-rich repeat 429..455 CDD:275381 11/25 (44%)
leucine-rich repeat 456..480 CDD:275381 7/23 (30%)
leucine-rich repeat 481..500 CDD:275381 10/19 (53%)
leucine-rich repeat 506..529 CDD:275381 7/22 (32%)
Skp2NP_001099886.1 F-box-like 97..142 CDD:289689 11/44 (25%)
leucine-rich repeat 137..167 CDD:275381 13/29 (45%)
leucine-rich repeat 183..207 CDD:275381 6/26 (23%)
AMN1 193..>345 CDD:187754 53/155 (34%)
leucine-rich repeat 208..231 CDD:275381 7/22 (32%)
leucine-rich repeat 232..257 CDD:275381 10/24 (42%)
leucine-rich repeat 258..283 CDD:275381 9/24 (38%)
leucine-rich repeat 285..311 CDD:275381 9/26 (35%)
leucine-rich repeat 312..336 CDD:275381 7/23 (30%)
leucine-rich repeat 337..356 CDD:275381 11/18 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346595
Domainoid 1 1.000 168 1.000 Domainoid score I3741
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55942
Inparanoid 1 1.050 212 1.000 Inparanoid score I3572
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005610
OrthoInspector 1 1.000 - - oto95656
orthoMCL 1 0.900 - - OOG6_109192
Panther 1 1.100 - - LDO PTHR16134
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.