DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and FBXL22

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_011519770.1 Gene:FBXL22 / 283807 HGNCID:27537 Length:260 Species:Homo sapiens


Alignment Length:105 Identity:28/105 - (26%)
Similarity:49/105 - (46%) Gaps:9/105 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 PNLIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAI-MKFKMLEYLSVSRCY 490
            |||..:.::||..|. |..:|.|.:.||:|..|.|.:|..:|...:.|: ...:.|:.|.|..|.
Human   149 PNLASVTLSGCGHVT-DDCLARLLRCCPRLRALRLENCARVTNRTLAAVAADGRALQTLHVDFCR 212

  Fly   491 LIPATKFIELK-SMPSLTYLDIFGMLSDTAMEVLEKQLPK 529
            .:.|.....|: :.|.|      .:.::.:..:|..|.|:
Human   213 NVSAAGLRRLRAACPRL------ALRAEHSAAMLPDQPPR 246

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689
leucine-rich repeat 302..327 CDD:275381
AMN1 309..480 CDD:187754 17/53 (32%)
leucine-rich repeat 328..352 CDD:275381
leucine-rich repeat 353..376 CDD:275381
leucine-rich repeat 377..402 CDD:275381