Sequence 1: | NP_730815.2 | Gene: | Skp2 / 40548 | FlyBaseID: | FBgn0037236 | Length: | 559 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036293.1 | Gene: | FBXL5 / 26234 | HGNCID: | 13602 | Length: | 691 | Species: | Homo sapiens |
Alignment Length: | 268 | Identity: | 53/268 - (19%) |
---|---|---|---|
Similarity: | 100/268 - (37%) | Gaps: | 77/268 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 228 MSAHINSGINYFERLSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLW------------- 279
Fly 280 -----TRLDLGLRTIRPGALEQIVRRGVLVIRLAQTSIQEPAFAPYTEVFRTRLQYLDLSMASIT 339
Fly 340 RSSLLTLLSHCRQLKKISLENIELDDDICAEIAKNEALEAVNLTMASGLTSNSVRLMMESLTSLS 404
Fly 405 SLNISWTDLSADAVTALVTHISPNLIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLTP 469
Fly 470 TVITAIMK 477 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Skp2 | NP_730815.2 | F-box-like | 239..284 | CDD:289689 | 13/62 (21%) |
leucine-rich repeat | 302..327 | CDD:275381 | 3/24 (13%) | ||
AMN1 | 309..480 | CDD:187754 | 32/169 (19%) | ||
leucine-rich repeat | 328..352 | CDD:275381 | 2/23 (9%) | ||
leucine-rich repeat | 353..376 | CDD:275381 | 3/22 (14%) | ||
leucine-rich repeat | 377..402 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 403..428 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 429..455 | CDD:275381 | 3/25 (12%) | ||
leucine-rich repeat | 456..480 | CDD:275381 | 8/22 (36%) | ||
leucine-rich repeat | 481..500 | CDD:275381 | |||
leucine-rich repeat | 506..529 | CDD:275381 | |||
FBXL5 | NP_036293.1 | Hemerythrin-like | 1..159 | ||
Hr_FBXL5 | 7..160 | CDD:213984 | |||
F-box-like | 205..249 | CDD:289689 | 12/46 (26%) | ||
leucine-rich repeat | 332..357 | CDD:275381 | 6/24 (25%) | ||
LRR 1 | 340..364 | 7/23 (30%) | |||
AMN1 | 354..>408 | CDD:187754 | 17/79 (22%) | ||
leucine-rich repeat | 358..384 | CDD:275381 | 9/51 (18%) | ||
LRR 2 | 365..392 | 11/52 (21%) | |||
leucine-rich repeat | 385..435 | CDD:275381 | 8/22 (36%) | ||
LRR 3 | 393..418 | 3/14 (21%) | |||
leucine-rich repeat | 436..500 | CDD:275381 | |||
LRR 4 | 479..508 | ||||
leucine-rich repeat | 501..537 | CDD:275381 | |||
leucine-rich repeat | 538..583 | CDD:275381 | |||
LRR 5 | 576..607 | ||||
leucine-rich repeat | 584..627 | CDD:275381 | |||
AMN1 | <603..>654 | CDD:187754 | |||
LRR 6 | 608..635 | ||||
leucine-rich repeat | 628..653 | CDD:275381 | |||
LRR 7 | 636..661 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165153056 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |