Sequence 1: | NP_730815.2 | Gene: | Skp2 / 40548 | FlyBaseID: | FBgn0037236 | Length: | 559 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036294.2 | Gene: | FBXL6 / 26233 | HGNCID: | 13603 | Length: | 539 | Species: | Homo sapiens |
Alignment Length: | 517 | Identity: | 96/517 - (18%) |
---|---|---|---|
Similarity: | 160/517 - (30%) | Gaps: | 194/517 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 QSAEKLQILAQAKRSSLGSEGSGNSNSPSKRLRNPLAAVTCNNQIDGTASLNFQPSTSRLAQVRQ 201
Fly 202 AKKPSTTNITTRIVAADSFFVFRTPAMSAHINSGINYFERLSDEILLDIFKWL-----PKKTLLR 261
Fly 262 MATVCRRFNRCSRDETLWTRLDL---------------------GLRTIRPGALEQIVRRGVL-- 303
Fly 304 ------VIRLAQTSIQEPAFAPYTEVFRTRLQYLDLS-MASITRSSLLTLLSHCRQLKKISLENI 361
Fly 362 ELDD----------------------------------DICAEIAKNEALEAVNLTMASGLTSNS 392
Fly 393 VRLMM---------ESLTSLSSLNISW---------------------------TDLSADAVTAL 421
Fly 422 VTHISPNLIRLNIAGCRRV------------LFDSHVA--------TL---------QKRCPQLL 457
Fly 458 ELDLSDCNSLTPTVITAIMKF--------KMLEYLSVSRCYLIPATKFIELKSMPSLTYLDI 511 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Skp2 | NP_730815.2 | F-box-like | 239..284 | CDD:289689 | 17/49 (35%) |
leucine-rich repeat | 302..327 | CDD:275381 | 2/32 (6%) | ||
AMN1 | 309..480 | CDD:187754 | 49/278 (18%) | ||
leucine-rich repeat | 328..352 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 353..376 | CDD:275381 | 3/56 (5%) | ||
leucine-rich repeat | 377..402 | CDD:275381 | 7/33 (21%) | ||
leucine-rich repeat | 403..428 | CDD:275381 | 7/51 (14%) | ||
leucine-rich repeat | 429..455 | CDD:275381 | 12/54 (22%) | ||
leucine-rich repeat | 456..480 | CDD:275381 | 8/31 (26%) | ||
leucine-rich repeat | 481..500 | CDD:275381 | 4/18 (22%) | ||
leucine-rich repeat | 506..529 | CDD:275381 | 3/6 (50%) | ||
FBXL6 | NP_036294.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..27 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 49..111 | 12/92 (13%) | |||
F-box-like | 113..163 | CDD:289689 | 17/49 (35%) | ||
LRR 1 | 177..203 | 4/25 (16%) | |||
AMN1 | 185..398 | CDD:187754 | 40/233 (17%) | ||
leucine-rich repeat | 196..221 | CDD:275381 | 3/37 (8%) | ||
LRR 2 | 204..229 | 6/37 (16%) | |||
leucine-rich repeat | 222..247 | CDD:275381 | 8/24 (33%) | ||
LRR 3 | 230..255 | 7/24 (29%) | |||
leucine-rich repeat | 248..299 | CDD:275381 | 3/50 (6%) | ||
LRR 4 | 281..307 | 3/33 (9%) | |||
leucine-rich repeat | 300..329 | CDD:275381 | 6/36 (17%) | ||
LRR 5 | 312..337 | 5/24 (21%) | |||
leucine-rich repeat | 330..357 | CDD:275381 | 5/26 (19%) | ||
LRR 6 | 341..365 | 0/23 (0%) | |||
AMN1 | <357..508 | CDD:187754 | 33/149 (22%) | ||
leucine-rich repeat | 358..385 | CDD:275381 | 3/26 (12%) | ||
LRR 7 | 368..393 | 7/24 (29%) | |||
leucine-rich repeat | 386..409 | CDD:275381 | 5/22 (23%) | ||
LRR 8 | 394..419 | 4/24 (17%) | |||
LRR 9 | 423..449 | 10/25 (40%) | |||
leucine-rich repeat | 442..474 | CDD:275381 | 8/31 (26%) | ||
LRR 10 | 453..481 | 4/27 (15%) | |||
leucine-rich repeat | 475..499 | CDD:275381 | 4/23 (17%) | ||
LRR 11 | 482..507 | 6/24 (25%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165152990 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR16134 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |