DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and FBXL2

DIOPT Version :10

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_054201991.1 Gene:FBXL2 / 25827 HGNCID:13598 Length:479 Species:Homo sapiens


Alignment Length:330 Identity:80/330 - (24%)
Similarity:145/330 - (43%) Gaps:67/330 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 ERLSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDL-GLRT-IRPGALEQIVRR-G 301
            ::|..|:||.||.:|...||.|.|.:.:.:|..:.|.:.|.|:|| ..:| :....:|.|.:| |
Human    38 KKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEGRVVENISKRCG 102

  Fly   302 VLVIRLAQTSIQEPAFAPYTEVFRTRLQYLDLSMASITRSSLLTLLSHCRQLKKISLEN-IELDD 365
            ..:.:|:..                       ....:..|||.|...:||.::.::|.. .::.|
Human   103 GFLRKLSLR-----------------------GCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITD 144

  Fly   366 DICAEIAK-NEALEAVNLTMASGLTSNSVRLMMESLTSLSSLNISWTD-LSADAVTALV------ 422
            ..|..::: ...|:.::||....:|::|::.:.|...:|..||:||.| ::.|.:.|||      
Human   145 STCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGL 209

  Fly   423 ----------------THIS---PNLIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLT 468
                            .||.   ..|:.||:..|.|:. |..|..:.:.|.:|..|.||.|::||
Human   210 KALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRIT-DEGVVQICRGCHRLQALCLSGCSNLT 273

  Fly   469 PTVITAI-MKFKMLEYLSVSRC-------YLIPATKFIELKSMPSLTYLDIFGMLSDTAMEVLEK 525
            ...:||: :....|:.|..:||       :.:.|....||:.|.    |:...:::|:.:..|..
Human   274 DASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMD----LEECILITDSTLIQLSI 334

  Fly   526 QLPKM 530
            ..||:
Human   335 HCPKL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box_DmSKP2-like 239..281 CDD:438920 14/40 (35%)
leucine-rich repeat 302..327 CDD:275381 1/24 (4%)
AMN1 309..480 CDD:187754 44/199 (22%)
leucine-rich repeat 328..352 CDD:275381 5/23 (22%)
leucine-rich repeat 353..376 CDD:275381 3/24 (13%)
leucine-rich repeat 377..402 CDD:275381 6/24 (25%)
leucine-rich repeat 403..428 CDD:275381 12/50 (24%)
leucine-rich repeat 429..455 CDD:275381 8/25 (32%)
leucine-rich repeat 456..480 CDD:275381 9/24 (38%)
leucine-rich repeat 481..500 CDD:275381 5/25 (20%)
leucine-rich repeat 506..529 CDD:275381 3/22 (14%)
FBXL2XP_054201991.1 F-box_FBXL2-like 34..78 CDD:438887 13/39 (33%)
leucine-rich repeat 77..104 CDD:275381 9/26 (35%)
AMN1 <101..248 CDD:187754 34/170 (20%)
leucine-rich repeat 105..124 CDD:275381 4/41 (10%)
leucine-rich repeat 131..156 CDD:275381 3/24 (13%)
leucine-rich repeat 157..182 CDD:275381 6/24 (25%)
leucine-rich repeat 183..208 CDD:275381 10/24 (42%)
AMN1 193..423 CDD:187754 36/152 (24%)
leucine-rich repeat 209..234 CDD:275381 2/24 (8%)
leucine-rich repeat 235..260 CDD:275381 8/25 (32%)
leucine-rich repeat 261..286 CDD:275381 9/24 (38%)
leucine-rich repeat 287..312 CDD:275381 5/24 (21%)
leucine-rich repeat 313..338 CDD:275381 5/28 (18%)
leucine-rich repeat 339..389 CDD:275381 0/1 (0%)
leucine-rich repeat 399..418 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.