DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and Fbxl18

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001028484.2 Gene:Fbxl18 / 231863 MGIID:2444450 Length:707 Species:Mus musculus


Alignment Length:649 Identity:112/649 - (17%)
Similarity:205/649 - (31%) Gaps:206/649 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SSSALSAIALAVSATSDDNSNETTPCASVSRMAHQLQHTQRLSLGSTGDITLDSPAVEDSLSMSR 136
            |.|.:..:|...|....:.|........:|::...|||.:.|::..:........:.|...::||
Mouse    97 SGSTIEHVARCHSLVKVNLSGCHLTSLRLSKVLSALQHLRSLAIDVSPGFDASQLSSECKATLSR 161

  Fly   137 -------------------QSAEKL----QILAQAKRSSL--GSEGSGNSNSPSKRLRNPLAAVT 176
                               .|.:||    :||.:.:..::  |....|.||.|..:         
Mouse   162 VQELKQTLFTPSYGVVPCCASLQKLLLYFEILDRTREGAVLSGQLMVGQSNVPHYQ--------- 217

  Fly   177 CNNQIDGTASLNFQPSTSRLAQVRQAKKPSTTN----------ITTRIVAADSFFVFRTPAMSAH 231
                       |.:...:|||       |...|          ::.|.......|:...|...|.
Mouse   218 -----------NLRVFYARLA-------PGYINQEVVRLYLAVLSDRTPENLHAFLISVPGSFAE 264

  Fly   232 INSGINYFERLSDEILLDIFK----WLPKKTLLRMATVCR----RFNRCS-RDETLWTRLDLGLR 287
            ..:..|..:.::..:.||..:    ||...|||:......    .|:||: ....|..||..|.:
Mouse   265 SGATKNLLDSMARNVALDALQLPKSWLNGSTLLQHMKFNNPFYFSFSRCTLSGGHLIQRLINGGK 329

  Fly   288 TIRPGALEQIVRRGVL-------VIRLAQTSIQEPAFAPYTEVFRTRLQYLDLSMASITRS---- 341
            .:|  :|..:...|.:       ::|.|:..|.........|.. ..|.:|:||.|....|    
Mouse   330 DLR--SLASLNLSGCVHCLSADSLLRKAEDDIDSSILETLVESC-CNLHHLNLSAAHHHSSDGLG 391

  Fly   342 ----SLLTLLSHCRQL-------------------------------KKISLENIELDDDICAEI 371
                .||..|.|.|.|                               ||:.:......:....:.
Mouse   392 RHLCQLLARLCHLRSLSLPVCSVADSAPRPDRAPAPPAMHAVPRGFGKKVRIGVQTCPNPFVGQS 456

  Fly   372 AKN---------------EALEAVNLTMASGLTSNSVRLMMESLTSLS-SLNISWTDLSADAVTA 420
            |..               |.||.:....:|.:..|...: ..||...| :.|:..::::|.....
Mouse   457 APQPASVFWSLLKKLPFLEHLELIGSNFSSAMPRNEPAI-RNSLPPCSRAQNVGDSEVAAIGQLT 520

  Fly   421 LVTHI-------------------------SPNLIRLNIAGCRRVLFDSHVATLQKRCPQLLEL- 459
            .:.|:                         |.:|..|.:.|  :|::...:|.:.|.|.:|.:| 
Mouse   521 FLRHLTLAQLPGMLTGSGLVSIGLQCQHLQSLSLANLGMMG--KVVYMPALADMLKHCKRLKDLR 583

  Fly   460 --------------DLSDCNSLTPTVIT---------AIMKFKMLEYLSVSRCYLIPATKFIELK 501
                          .|..|:||....:.         |::.| |...|.|..|::.........|
Mouse   584 LEQPYFNANAQFFQALGQCSSLQRLCLVSRSGTLQPDAVLAF-MARCLQVVMCHMFTGESLTTCK 647

  Fly   502 SM------------PSLTYLDIFGMLSDTAMEVLEKQLPKMGINKFIHSSVSRPTVGTRRTSIW 553
            |:            |:|..: ||.:|.:...:|: :.:|.:.:::.   ::.:..|.....::|
Mouse   648 SLQQSLLRSFQAERPALNVV-IFPLLHEGLTDVI-RDVPMLHLDEI---TLFKSRVAEEPPNLW 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 13/53 (25%)
leucine-rich repeat 302..327 CDD:275381 4/31 (13%)
AMN1 309..480 CDD:187754 44/274 (16%)
leucine-rich repeat 328..352 CDD:275381 10/31 (32%)
leucine-rich repeat 353..376 CDD:275381 4/68 (6%)
leucine-rich repeat 377..402 CDD:275381 6/24 (25%)
leucine-rich repeat 403..428 CDD:275381 5/50 (10%)
leucine-rich repeat 429..455 CDD:275381 7/25 (28%)
leucine-rich repeat 456..480 CDD:275381 8/47 (17%)
leucine-rich repeat 481..500 CDD:275381 3/18 (17%)
leucine-rich repeat 506..529 CDD:275381 5/22 (23%)
Fbxl18NP_001028484.2 F-box-like 22..64 CDD:289689
leucine-rich repeat 85..109 CDD:275381 3/11 (27%)
leucine-rich repeat 110..131 CDD:275381 2/20 (10%)
leucine-rich repeat 308..330 CDD:275381 7/21 (33%)
leucine-rich repeat 331..373 CDD:275381 7/44 (16%)
leucine-rich repeat 374..403 CDD:275381 9/28 (32%)
leucine-rich repeat 404..473 CDD:275381 5/68 (7%)
leucine-rich repeat 522..548 CDD:275381 1/25 (4%)
leucine-rich repeat 549..578 CDD:275381 8/30 (27%)
leucine-rich repeat 579..604 CDD:275381 4/24 (17%)
leucine-rich repeat 605..629 CDD:275381 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.