Sequence 1: | NP_730815.2 | Gene: | Skp2 / 40548 | FlyBaseID: | FBgn0037236 | Length: | 559 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001362175.1 | Gene: | K05C4.9 / 187021 | WormBaseID: | WBGene00010585 | Length: | 718 | Species: | Caenorhabditis elegans |
Alignment Length: | 269 | Identity: | 56/269 - (20%) |
---|---|---|---|
Similarity: | 113/269 - (42%) | Gaps: | 52/269 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 303 LVIRLAQTSIQEPAFAPYTEVFRTRLQYLDLSMASITRSSLLTLLSHCRQLK----KISLENIEL 363
Fly 364 -DDDIC---AEIAKNE-ALEAVNL----------TMASGLTSNSVRLMMESLTS-----LSSLNI 408
Fly 409 SWTDLSADAVTALVTHISPNLIRLNIAGCRRVLFDSHVATLQKRC---PQLLELDLSDCNSLTPT 470
Fly 471 VITAIMKFKMLEYLSVSRCYLIPATKFIELKSMPSLTYLDIFGMLS-DTAMEVLEKQLPKMGINK 534
Fly 535 FIHSSVSRP 543 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Skp2 | NP_730815.2 | F-box-like | 239..284 | CDD:289689 | |
leucine-rich repeat | 302..327 | CDD:275381 | 7/23 (30%) | ||
AMN1 | 309..480 | CDD:187754 | 41/197 (21%) | ||
leucine-rich repeat | 328..352 | CDD:275381 | 2/23 (9%) | ||
leucine-rich repeat | 353..376 | CDD:275381 | 5/31 (16%) | ||
leucine-rich repeat | 377..402 | CDD:275381 | 9/34 (26%) | ||
leucine-rich repeat | 403..428 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 429..455 | CDD:275381 | 7/28 (25%) | ||
leucine-rich repeat | 456..480 | CDD:275381 | 5/23 (22%) | ||
leucine-rich repeat | 481..500 | CDD:275381 | 4/18 (22%) | ||
leucine-rich repeat | 506..529 | CDD:275381 | 6/23 (26%) | ||
K05C4.9 | NP_001362175.1 | leucine-rich repeat | 126..151 | CDD:275381 | 5/24 (21%) |
leucine-rich repeat | 152..176 | CDD:275381 | 7/28 (25%) | ||
leucine-rich repeat | 177..198 | CDD:275378 | 5/23 (22%) | ||
leucine-rich repeat | 199..223 | CDD:275378 | 5/23 (22%) | ||
leucine-rich repeat | 224..253 | CDD:275378 | 8/39 (21%) | ||
leucine-rich repeat | 254..278 | CDD:275378 | |||
leucine-rich repeat | 279..290 | CDD:275378 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160162741 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |