DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and F53G2.1

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_494284.1 Gene:F53G2.1 / 186184 WormBaseID:WBGene00018766 Length:714 Species:Caenorhabditis elegans


Alignment Length:235 Identity:56/235 - (23%)
Similarity:92/235 - (39%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 LKKISLENIELDDDICAEIAKNEALEAVNLTMASGLTS---------NSVRLMMESLTSLSSLNI 408
            |.:||.:|.. :..|..||.:...|:::.|.....:.|         |...|:...|...|..|:
 Worm    60 LSEISFKNFP-NSTIYVEILQKSCLKSLCLGNLKNIASFFEDDQKSINICYLLSYYLNEDSRRNL 123

  Fly   409 SWTDLS-----ADAVTALVTHISPNLIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCN--- 465
            ...|||     :...|..:.|:.|:|..|:|.|  |.|:......:.:..|:|:.||:||.|   
 Worm   124 QTLDLSGKEEFSTGWTVKIGHMFPSLTTLSIRG--RTLYKKEFLVVCQNFPKLISLDISDTNVQL 186

  Fly   466 -----------SLTPTVITAIMKF--------KMLEYLSVSRCYLIPATKFIEL-----KSMPSL 506
                       .||...:|.:..|        ..||:|.:||..|....|.:..     ..:.:|
 Worm   187 LFGISYLIHLRELTMQNLTFLSHFVWLDLFHLSGLEFLDISRDKLNKDMKTVRQYVDCGMGLSNL 251

  Fly   507 TYLDIFGM-LSDTAMEVLEKQLPKMGINKFIHSSVSRPTV 545
            .:||..|. :.|..::.|:...||:.......|.:.|.|:
 Worm   252 RFLDCSGTDIDDQLVQCLQLSHPKLKQICVFDSVLQRSTI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689
leucine-rich repeat 302..327 CDD:275381
AMN1 309..480 CDD:187754 38/162 (23%)
leucine-rich repeat 328..352 CDD:275381
leucine-rich repeat 353..376 CDD:275381 7/22 (32%)
leucine-rich repeat 377..402 CDD:275381 6/33 (18%)
leucine-rich repeat 403..428 CDD:275381 7/29 (24%)
leucine-rich repeat 429..455 CDD:275381 6/25 (24%)
leucine-rich repeat 456..480 CDD:275381 10/45 (22%)
leucine-rich repeat 481..500 CDD:275381 7/18 (39%)
leucine-rich repeat 506..529 CDD:275381 6/23 (26%)
F53G2.1NP_494284.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.