DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and C48D1.1

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001040928.2 Gene:C48D1.1 / 178271 WormBaseID:WBGene00008177 Length:632 Species:Caenorhabditis elegans


Alignment Length:421 Identity:92/421 - (21%)
Similarity:158/421 - (37%) Gaps:107/421 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LNFQPSTSRLAQVRQAKKPSTTNITT-RIVAADSFFVFR-------------TPAMSAHINSGIN 237
            :...|.|......||.|:.|...:.. ....:.|:.:||             ...::......:.
 Worm    61 VTLHPQTLDENTARQLKQFSLKELKIGNFSKSKSWCIFRRKETRHVDIVRILEAVLNEETRKNLQ 125

  Fly   238 YFERLSDEILLDIFKW-------LPKKTLLRMATV-------CRRFNRCSRDETLWTRLDL-GLR 287
            |.....|:.|:.  :|       ||..|.|.|:.|       .:.|...|...:    ||: |..
 Worm   126 YLHIEKDQKLMK--RWTAKIGNMLPSLTHLTMSDVHINEDDFYQLFGNFSNLRS----LDISGTN 184

  Fly   288 TIRPGALEQIVRRGVLVIRLAQTSIQEPAFAPYTE---VFRTR-LQYLDLSMASI---TRSSLLT 345
            .:....:.::.:..||.:|       :.:.|.|||   :|..: |:.||:|....   :|::::.
 Worm   185 ILNIAGISRLKQLEVLALR-------DFSIATYTELKDLFNLKHLRVLDVSQTRFNLHSRNNIVE 242

  Fly   346 LLSHCR----QLKKISLENIELDDDICAEIAKNEA-LEAVNLTMASGLTS--NSVRLMMESLTSL 403
            ..:.|:    :|:.:......|..||...:.|.:. |:.|...|....||  |.||:        
 Worm   243 QFTECKMELPELRFMDCTRTSLSGDILECLLKTQRNLQLVTTIMTEAETSQYNDVRV-------- 299

  Fly   404 SSLNISWTDLSADAVTALVT--------------HIS---PNLIRLNIAGCRRVL------FDSH 445
              ||.::...|..|:...:|              .||   .||..|||..|.:.:      ||| 
 Worm   300 --LNTAYFHKSVQALVYCLTARKEFDSGYCMKAIRISISEDNLQNLNIPSCIKTIVKSMQTFDS- 361

  Fly   446 VATLQK--RCPQLLELDLSD--CNSLTPTVITAIMKFKML-------EYLSVSRCYLIPATKFIE 499
            ::..|.  :|..:..:..|:  |::....::.|:|.|..|       .|:.|:..|.....|.:.
 Worm   362 ISVTQNGLKCLIIFGMLYSNQLCSNGVTLLVEALMSFVYLYKRMISEAYVKVNISYWNAVEKLVN 426

  Fly   500 LKSMPSLTYLDIFGMLSDTAME-VLEKQLPK 529
            ||    |..|| |..:|.|||. :||.::.|
 Worm   427 LK----LGKLD-FDKISKTAMSFLLENRVSK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 12/58 (21%)
leucine-rich repeat 302..327 CDD:275381 8/27 (30%)
AMN1 309..480 CDD:187754 47/211 (22%)
leucine-rich repeat 328..352 CDD:275381 6/30 (20%)
leucine-rich repeat 353..376 CDD:275381 5/22 (23%)
leucine-rich repeat 377..402 CDD:275381 8/26 (31%)
leucine-rich repeat 403..428 CDD:275381 7/41 (17%)
leucine-rich repeat 429..455 CDD:275381 10/33 (30%)
leucine-rich repeat 456..480 CDD:275381 5/25 (20%)
leucine-rich repeat 481..500 CDD:275381 5/25 (20%)
leucine-rich repeat 506..529 CDD:275381 10/23 (43%)
C48D1.1NP_001040928.2 leucine-rich repeat 124..149 CDD:275380 5/26 (19%)
leucine-rich repeat 150..174 CDD:275380 5/23 (22%)
leucine-rich repeat 175..196 CDD:275380 3/24 (13%)
leucine-rich repeat 197..221 CDD:275380 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.