DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and gadr-4

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001317764.1 Gene:gadr-4 / 173745 WormBaseID:WBGene00021053 Length:797 Species:Caenorhabditis elegans


Alignment Length:315 Identity:66/315 - (20%)
Similarity:119/315 - (37%) Gaps:94/315 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 INSGINYFERLSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLDLGLRTIRPGALEQ 296
            :|.|..|  |:.::|:                   .:||..:        :|.|.:.:..|.|:.
 Worm   130 MNDGWTY--RIKEQII-------------------EKFNLIT--------MDFGKKRLYRGILDI 165

  Fly   297 IVRRGVLVIRLAQTSIQEPAFAPYTEVFRTRLQYLDLSMASITRSSL----LTLLSHCRQLKKIS 357
            :....:..|:|.:..:.|..:..     |:....:|:||  :.:|:|    ..||.|        
 Worm   166 LKAMPIQSIKLGKLDLIENDYKQ-----RSDKSSIDISM--LIKSALSDNSRALLQH-------- 215

  Fly   358 LENIELDDDICAEIAKNEALEAVNLTMASGLTSNSVRLMMESLTSLSSLNISWTDLSADAVTALV 422
                       .:|...|.| ::|.....||.          |.||:||::..........|.|.
 Worm   216 -----------LDIEGREVL-SINWPRKIGLL----------LPSLASLHVKGRSFFVFEFTQLC 258

  Fly   423 THISPNLIRLNIAG--CRRVLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAIMKFKMLEYLS 485
            ... ||||.|||:|  .:.:...|.:..|:....|.||::       |...:..:.....|::|.
 Worm   259 RSF-PNLISLNISGTNIKNLNGISALKRLEVLSMQFLEIE-------TTEHLINLFNLSNLKFLD 315

  Fly   486 VS------RCYLIPATKFIEL-KSMPSLTYLDIFGMLSDTAMEVLEKQL---PKM 530
            :|      .|.::..  ::|. |.:|:|.::|.  ..:|...::|||.|   ||:
 Worm   316 ISDIPEYDSCIIVHL--YVECGKGLPNLKFMDC--TATDINNDLLEKILISHPKL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 4/44 (9%)
leucine-rich repeat 302..327 CDD:275381 4/24 (17%)
AMN1 309..480 CDD:187754 37/176 (21%)
leucine-rich repeat 328..352 CDD:275381 8/27 (30%)
leucine-rich repeat 353..376 CDD:275381 1/22 (5%)
leucine-rich repeat 377..402 CDD:275381 5/24 (21%)
leucine-rich repeat 403..428 CDD:275381 5/24 (21%)
leucine-rich repeat 429..455 CDD:275381 8/27 (30%)
leucine-rich repeat 456..480 CDD:275381 3/23 (13%)
leucine-rich repeat 481..500 CDD:275381 4/24 (17%)
leucine-rich repeat 506..529 CDD:275381 7/25 (28%)
gadr-4NP_001317764.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.