DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and CG44004

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001262004.2 Gene:CG44004 / 14462879 FlyBaseID:FBgn0264746 Length:368 Species:Drosophila melanogaster


Alignment Length:236 Identity:55/236 - (23%)
Similarity:97/236 - (41%) Gaps:63/236 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 FRTRLQYLDLSMASITRS----SLLTLLSHCRQLKKISLENIELDDDICAEIAKNEALEAVNLTM 384
            |..::..|.||::...||    .:|.::....|||::|::.. :|::: .||.|..|||.:|:..
  Fly   120 FLRKINKLLLSLSLEQRSRFPFEILKVVGEMTQLKELSVKGY-IDENV-NEIQKLVALEKLNIEQ 182

  Fly   385 ASGLTSNSVRLM--MESLTSLSSLNIS--------------WTDLSADAVTALVTHISPNLIRLN 433
            ...|....|.::  ..||::|..|.|:              |.||  :.:..::..::|.|    
  Fly   183 HYYLDKPDVNILRICSSLSNLRKLTINNVHIISCEEPHSKMWADL--ETLKLIICALTPEL---- 241

  Fly   434 IAGCRRVLFDSHVATLQKRCPQLLELDLSDC-NSLTPTVITAIMK----FKMLEYLSVSRCY-LI 492
                             ..||.|..||:... ||....::..|:|    .|.|    ..||: .|
  Fly   242 -----------------PDCPNLKVLDIHYLRNSNEGYILKFILKNGRNLKTL----YERCHPPI 285

  Fly   493 PATKFIE-LKSMPSLTYL-------DIFGMLSDTAMEVLEK 525
            .|..|:: |:..|:|.||       .::.....|.:|:|.:
  Fly   286 DANGFLQLLRGCPNLRYLYTPLEYIKLYAAYLSTIVEILRE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689
leucine-rich repeat 302..327 CDD:275381 1/2 (50%)
AMN1 309..480 CDD:187754 40/180 (22%)
leucine-rich repeat 328..352 CDD:275381 6/27 (22%)
leucine-rich repeat 353..376 CDD:275381 7/22 (32%)
leucine-rich repeat 377..402 CDD:275381 7/26 (27%)
leucine-rich repeat 403..428 CDD:275381 6/38 (16%)
leucine-rich repeat 429..455 CDD:275381 2/25 (8%)
leucine-rich repeat 456..480 CDD:275381 7/28 (25%)
leucine-rich repeat 481..500 CDD:275381 6/20 (30%)
leucine-rich repeat 506..529 CDD:275381 6/27 (22%)
CG44004NP_001262004.2 leucine-rich repeat 75..101 CDD:275381
leucine-rich repeat 121..152 CDD:275381 6/30 (20%)
leucine-rich repeat 153..172 CDD:275381 6/20 (30%)
leucine-rich repeat 175..202 CDD:275381 7/26 (27%)
leucine-rich repeat 203..226 CDD:275381 4/22 (18%)
leucine-rich repeat 247..273 CDD:275381 7/25 (28%)
leucine-rich repeat 274..299 CDD:275381 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.