DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and LOC110437745

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_021323868.1 Gene:LOC110437745 / 110437745 -ID:- Length:579 Species:Danio rerio


Alignment Length:236 Identity:50/236 - (21%)
Similarity:85/236 - (36%) Gaps:65/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SVVG---ALVSTTKSSHYEHPSSPSALTFEALEEMGIGMLDSEESSSSALSAIALAVSATSDDNS 91
            :|:|   .:||..:|...:.....:.|..:|:.:..||.|.|.:::|..:          .|:..
Zfish   269 AVIGRGQRMVSQQESKLAQLQEHRARLEAQAISDDHIGFLQSFQAASGPM----------QDEAG 323

  Fly    92 NETTPCASVSRMAHQLQHTQRLSLG----STGDITLDSPAVEDSLSMSRQSAEKLQILAQAKRSS 152
            .|.         ..:.:.|.|.|||    :.|:|   ...:||..|...|....:..||::: |.
Zfish   324 QEA---------EQEAELTLRFSLGDVKAALGEI---RDRLEDIRSGEVQYRHSVSTLAESE-SM 375

  Fly   153 LGSEGSGNSNSPSKRLRNPLAAVTCNNQIDG---TASLNFQPSTS---------RLAQVRQAKKP 205
            :........:...|.||.   ..|.:.::.|   ..|||  |.|:         |....|..|..
Zfish   376 MSVRSMRRKDWSLKDLRR---IKTGHKKVKGYLEDVSLN--PVTAYPFLILSEDRKQLKRGEKLQ 435

  Fly   206 STTNITTR------IVAADSFFVFRTPAMSAHINSGINYFE 240
            ...|.|.|      ::|.:||            .:|.:|:|
Zfish   436 FYRNNTQRYDVWSCVLAKESF------------QTGRHYWE 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 1/2 (50%)
leucine-rich repeat 302..327 CDD:275381
AMN1 309..480 CDD:187754
leucine-rich repeat 328..352 CDD:275381
leucine-rich repeat 353..376 CDD:275381
leucine-rich repeat 377..402 CDD:275381
leucine-rich repeat 403..428 CDD:275381
leucine-rich repeat 429..455 CDD:275381
leucine-rich repeat 456..480 CDD:275381
leucine-rich repeat 481..500 CDD:275381
leucine-rich repeat 506..529 CDD:275381
LOC110437745XP_021323868.1 RAD18 8..>99 CDD:333230
RING_Ubox 10..53 CDD:327409
zf-B_box 152..191 CDD:306989
SMC_N <213..>393 CDD:330553 30/146 (21%)
SPRY_PRY_C-I_1 407..575 CDD:293968 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.