DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and fbxl18

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_002931545.1 Gene:fbxl18 / 100492578 XenbaseID:XB-GENE-980052 Length:692 Species:Xenopus tropicalis


Alignment Length:473 Identity:91/473 - (19%)
Similarity:156/473 - (32%) Gaps:185/473 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LSDEILLDIFKWLPKKTL-LRMATVCRRFNRCSRDETLWTRLDLGLR-TIRPGALEQIVRRGVLV 304
            |||||||.|..::|...| |.:...|.:......|::|..::.|... ......::|::|.....
 Frog     6 LSDEILLHILSYVPSTDLILNVKRTCHKLAGLCLDKSLIQKVILHKEYQASDNQVKQLLREAGKE 70

  Fly   305 IR---------LAQTSIQEPAFAPYTEVFRTRLQYLDLS---MASITRSSLLT------------ 345
            ||         |:.:::...|..       .||..||||   :.|:..|.|||            
 Frog    71 IRELDMSGCYWLSSSTVDLIAQC-------KRLVRLDLSGCPLTSLRLSKLLTDLHQLCSLSIDI 128

  Fly   346 ---------------LLSHCRQLKK-------------ISLENIELDDDIC-------------- 368
                           .|.|.|:||:             |:||.:.|..::.              
 Frog   129 GAGFDSGQLTTECKATLRHVRELKQTLFAPSYGVVPCCINLEKLLLYFEVLDRTREGTVMSGQLM 193

  Fly   369 ----------------AEIAK---NEALEAVNLTMASGLTSNSVRLMMESL-----TSLSSLNI- 408
                            |.:|.   ||.:..:.||:.:..|..::|..:.|:     .|.:|.|: 
 Frog   194 VGESKIPHYQNLRLFYARLAPGYINEEVVRLYLTVLTDRTPENLRAFLISVPGSLAESSASKNLL 258

  Fly   409 ----------------SWTDLSADAVTALVTHISP---------------------------NLI 430
                            ||  ||..::...:...||                           :|:
 Frog   259 DSMAKNVSLEAFQLPKSW--LSGSSLLQNLKFSSPFYLSFSRSMISGGQLTQWVINGHMDCRSLV 321

  Fly   431 RLNIAGC----------RRVLFD---SHVATLQKRCPQLLELDLS-----DCNSLTPTVITAIMK 477
            .||:.||          |:.:.|   :.:.||...||.|..|:||     ...|.|..:...:.:
 Frog   322 SLNLRGCPFSLNSDLPFRKTVEDIDCNILETLVTACPNLAHLNLSYAHHHSSESATRHLCDILAQ 386

  Fly   478 FKMLEYLSVSRCYLIPATKFIELKSMPSLTYLDIFGMLSDTAMEVLEKQLPK---MGINKFIHSS 539
            .|.|..||:..|.::..:...: ||:                ::...:..|:   :|..|.:...
 Frog   387 LKHLRSLSLPVCAIVNTSNTTD-KSL----------------IQCPGQSTPRTATLGFGKKVRIG 434

  Fly   540 V--SRPTVGTRRTSIWGL 555
            |  :..|:..:.:|.|.|
 Frog   435 VQTNSMTLPDQNSSFWKL 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 14/42 (33%)
leucine-rich repeat 302..327 CDD:275381 4/33 (12%)
AMN1 309..480 CDD:187754 56/313 (18%)
leucine-rich repeat 328..352 CDD:275381 12/53 (23%)
leucine-rich repeat 353..376 CDD:275381 9/68 (13%)
leucine-rich repeat 377..402 CDD:275381 5/29 (17%)
leucine-rich repeat 403..428 CDD:275381 8/68 (12%)
leucine-rich repeat 429..455 CDD:275381 10/38 (26%)
leucine-rich repeat 456..480 CDD:275381 6/28 (21%)
leucine-rich repeat 481..500 CDD:275381 4/18 (22%)
leucine-rich repeat 506..529 CDD:275381 0/22 (0%)
fbxl18XP_002931545.1 F-box-like 8..43 CDD:372399 11/34 (32%)
leucine-rich repeat 18..43 CDD:275381 5/24 (21%)
leucine-rich repeat 44..68 CDD:275381 3/23 (13%)
leucine-rich repeat 71..95 CDD:275381 4/30 (13%)
leucine-rich repeat 96..120 CDD:275381 10/23 (43%)
leucine-rich repeat 320..359 CDD:275381 10/38 (26%)
leucine-rich repeat 360..389 CDD:275381 6/28 (21%)
leucine-rich repeat 459..506 CDD:275381
leucine-rich repeat 507..533 CDD:275381
leucine-rich repeat 534..563 CDD:275381
leucine-rich repeat 564..589 CDD:275381
leucine-rich repeat 590..616 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.