DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Skp2 and si:ch211-214j8.12

DIOPT Version :9

Sequence 1:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001091661.1 Gene:si:ch211-214j8.12 / 100000539 ZFINID:ZDB-GENE-060526-102 Length:627 Species:Danio rerio


Alignment Length:547 Identity:111/547 - (20%)
Similarity:193/547 - (35%) Gaps:171/547 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CPVTRKRSTNK-NHVSVVGALVSTTKSSHYEHPSSPSALTFEALEEMGIGMLDSEESSSSALSAI 79
            ||..:....:: .|::..|.|....:.:|..     |..|..:|..:.||:.::|..:.||::.:
Zfish   178 CPKLKHLDVSRCLHLTPAGLLPLAYREAHVN-----STNTISSLLALDIGLAENEGDAVSAVAFL 237

  Fly    80 ALAVSATSDDNSNETTPCASVSRMAHQLQHTQRLSLGSTGDITLDSPAVEDSLSMSRQ------- 137
            .|:                        |...|||::...|...:        |.::|:       
Zfish   238 LLS------------------------LPGLQRLAVEGLGQACV--------LILNREFEGTEEF 270

  Fly   138 -SAEKLQILAQ--AKRSSLGSEGSGNSNSPSKRLRNPLAAVTCNNQIDGTASLNFQPSTSRLAQV 199
             |.|.:|.|..  ||: :|....|.::|...:        .|...::|...||:  .|.||:.:.
Zfish   271 TSREGVQCLKDLWAKK-TLDGRSSMSANGEER--------FTLEGKLDECLSLD--ESESRVNEW 324

  Fly   200 RQAKKPSTTNITTRIVAADSFFVFRTPAMSAHINSGINYFERLSDEI---LLDIFKWLPKKTLLR 261
            ....|.....:.:.||                           ||.:   |.|: :.|...||..
Zfish   325 TGTSKECDEKVRSHIV---------------------------SDNVTTCLKDV-QGLSLDTLEA 361

  Fly   262 MATVCRRFNRCSRDETLWTRLDLGLRTIRPGALEQIV-----RRGVLVIR--------LAQTSIQ 313
            :..||..                 ||.:....|:.||     ..|.::.|        |...|:|
Zfish   362 VGKVCPE-----------------LRVLSLDCLQNIVNADSFEHGAVLARGLGRFSGQLNSLSLQ 409

  Fly   314 EPAFAPYTEVFRTRLQ-----YLDLSMASIT---RSSLLTLLSHCRQLKKISLE----NIELDDD 366
               ||.:.......||     .|.||:..|.   .::.|.|:..|.:|..:|:.    |..:|:|
Zfish   410 ---FAGFLSDLVPALQAAGSNLLSLSLEGIKADGHTAFLELIRACPRLTSLSIHLDPPNSNMDED 471

  Fly   367 ICAEIAKNEALEAVNLTMASGLTSNSVRL-MMESLTSLSSLN-------ISWTDLSADAVTALVT 423
            ...|.|::|           |..||...: .:.|||...||:       :.||.|. |.:.||:.
Zfish   472 DEDEDAEDE-----------GRLSNLPCIPHLRSLTLHFSLDERQMKPPLCWTSLK-DVLWALLR 524

  Fly   424 HISPNLIRLNIAG--CR-----RVLFDSHVATLQK------RCPQLLELDLSDCNSLTPTVITAI 475
            ..| .|.:|::..  ||     :::.:.....|..      :|.:...|:.||..  ..||:..:
Zfish   525 GAS-LLQKLSLIAVPCRLDPVFKLVLNHPAKPLDALDNPPLQCLRSASLNRSDIT--MDTVVHVV 586

  Fly   476 MKFKMLEYLSVSRCYLIPATKFIELKS 502
            ...:.|..|.:|.|:.:..:...:|:|
Zfish   587 NTCRRLSCLDLSGCWEMSLSNITKLQS 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 9/47 (19%)
leucine-rich repeat 302..327 CDD:275381 6/32 (19%)
AMN1 309..480 CDD:187754 47/203 (23%)
leucine-rich repeat 328..352 CDD:275381 9/31 (29%)
leucine-rich repeat 353..376 CDD:275381 7/26 (27%)
leucine-rich repeat 377..402 CDD:275381 5/25 (20%)
leucine-rich repeat 403..428 CDD:275381 9/31 (29%)
leucine-rich repeat 429..455 CDD:275381 6/38 (16%)
leucine-rich repeat 456..480 CDD:275381 5/23 (22%)
leucine-rich repeat 481..500 CDD:275381 4/18 (22%)
leucine-rich repeat 506..529 CDD:275381
si:ch211-214j8.12NP_001091661.1 AMN1 122..>201 CDD:187754 5/22 (23%)
leucine-rich repeat 130..155 CDD:275381
leucine-rich repeat 156..180 CDD:275381 1/1 (100%)
leucine-rich repeat 181..215 CDD:275381 6/38 (16%)
leucine-rich repeat 216..243 CDD:275381 8/50 (16%)
leucine-rich repeat 314..368 CDD:275381 16/83 (19%)
leucine-rich repeat 403..427 CDD:275381 7/26 (27%)
leucine-rich repeat 428..453 CDD:275381 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.