DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1103 and Clrn2

DIOPT Version :9

Sequence 1:NP_001036660.1 Gene:CG1103 / 40547 FlyBaseID:FBgn0037235 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001156789.1 Gene:Clrn2 / 624224 MGIID:3646230 Length:232 Species:Mus musculus


Alignment Length:216 Identity:44/216 - (20%)
Similarity:85/216 - (39%) Gaps:44/216 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVFSTFFGSCLAIGLLLVSMTTNHWV------RATPRRKNSSDAK-----GEFNFGLFFGNYHLN 66
            |.||:|.       |::|:::..||:      :......|::|.:     |:..:|||.|.....
Mouse    16 LSFSSFL-------LIIVALSLPHWLSGKILCQTGVDLVNATDPELVKFIGDIYYGLFRGCKVRQ 73

  Fly    67 PGFGVRTNSVDVYT-FVRTENDDTSFWLWLLTTLGTGFALLACAVAAIAAVLKSASAAKKGGTMM 130
            .|.|.|.:...::. .|:..|......:.||..|....||::...|.:..:.....|....|.:.
Mouse    74 CGLGGRQSQFTIFPHLVKELNAGLHVTILLLLFLALALALVSMGFAILNIIQVPYRAVNGPGGIC 138

  Fly   131 LLLTSNICAAGAQIVAFVAWL--VQF---------YQYFIHNVLLTEQQQQHWYSNGLAYLGYSF 184
            |.   |:.|.|...:|..:::  |:|         :|..:...::.|:|.:.           ||
Mouse   139 LW---NVLAGGVVALAIGSFMAAVKFHDLTERIANFQERLFQFVVVEEQYEE-----------SF 189

  Fly   185 YLVVVSTVVVLLNIAILLYAQ 205
            ::.|.|......|:.::..:|
Mouse   190 WICVASASAHAANLVVVAISQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1103NP_001036660.1 Claudin_2 22..203 CDD:258170 39/203 (19%)
Clrn2NP_001156789.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1188976at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31548
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.