DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1103 and clrn1

DIOPT Version :9

Sequence 1:NP_001036660.1 Gene:CG1103 / 40547 FlyBaseID:FBgn0037235 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001002671.1 Gene:clrn1 / 436944 ZFINID:ZDB-GENE-040718-420 Length:232 Species:Danio rerio


Alignment Length:246 Identity:56/246 - (22%)
Similarity:85/246 - (34%) Gaps:93/246 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RALVFSTFFGSCLAIGLLLV---SMTTNHWVRATPRRK------NSSDAK-----GEFNFGLFFG 61
            :.::||  ....|..|.:||   :|.|..||:|....|      |:|.|:     |:.|:|||.|
Zfish     6 KQVIFS--IAGVLCFGCVLVVAAAMGTQFWVQAAVLCKTGAQIVNASGAELGKFIGKANYGLFHG 68

  Fly    62 NYHLNPGFGVRTNSVDVYTFVRTENDDTSFWLWLLTTLGTGFALLACAVAAIAAVLKSASAAKKG 126
            :.....|.|.|.     :.|        ||:..|:..:.   |.|..:|....:||...|:...|
Zfish    69 HGMKQCGLGDRP-----FYF--------SFFPDLMDVVP---ASLHVSVIFFCSVLIVFSSVCCG 117

  Fly   127 ------------------GTMMLLLTSNICAAGAQIV--------------------AFV----- 148
                              |..:..:.|:.||....|:                    :||     
Zfish   118 FFFYNAFGSPYETLHGPQGLYLWNMISSFCACLVLILFSSEVKLHHLTEIIFNFNEGSFVYKTHS 182

  Fly   149 ------AWLVQFYQYFIH--NVLLT---------EQQQQHWYSNGLAYLGY 182
                  .||: |..:.:|  ||||.         :|.::...|.|.|.|.|
Zfish   183 ECYDRSFWLI-FLTFLLHGLNVLLIRLAGIQFPFQQAKESDASTGAADLMY 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1103NP_001036660.1 Claudin_2 22..203 CDD:258170 54/235 (23%)
clrn1NP_001002671.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1188976at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31548
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.