Sequence 1: | NP_001036660.1 | Gene: | CG1103 / 40547 | FlyBaseID: | FBgn0037235 | Length: | 230 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002671.1 | Gene: | clrn1 / 436944 | ZFINID: | ZDB-GENE-040718-420 | Length: | 232 | Species: | Danio rerio |
Alignment Length: | 246 | Identity: | 56/246 - (22%) |
---|---|---|---|
Similarity: | 85/246 - (34%) | Gaps: | 93/246 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 RALVFSTFFGSCLAIGLLLV---SMTTNHWVRATPRRK------NSSDAK-----GEFNFGLFFG 61
Fly 62 NYHLNPGFGVRTNSVDVYTFVRTENDDTSFWLWLLTTLGTGFALLACAVAAIAAVLKSASAAKKG 126
Fly 127 ------------------GTMMLLLTSNICAAGAQIV--------------------AFV----- 148
Fly 149 ------AWLVQFYQYFIH--NVLLT---------EQQQQHWYSNGLAYLGY 182 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1103 | NP_001036660.1 | Claudin_2 | 22..203 | CDD:258170 | 54/235 (23%) |
clrn1 | NP_001002671.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170586526 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1188976at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR31548 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.040 |