DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1103 and Clrn3

DIOPT Version :9

Sequence 1:NP_001036660.1 Gene:CG1103 / 40547 FlyBaseID:FBgn0037235 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_848784.1 Gene:Clrn3 / 212070 MGIID:2142022 Length:226 Species:Mus musculus


Alignment Length:234 Identity:50/234 - (21%)
Similarity:90/234 - (38%) Gaps:42/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FSTFFGSCLAIGLLLVSMTTNHWVRATPRRKNSSDAKGE----FNFGLFFGN--YHLNPGFGVRT 73
            |.|..||.:.|..:|   .|..|:.:   |...:||...    ..:|||.|.  ..||.|.....
Mouse    14 FLTSLGSVVVICSIL---ATQAWITS---RIFFTDAISNGTIVITYGLFRGTSAQELNEGLQDLD 72

  Fly    74 NSVDVYTFVRTENDDTSFWLWLLTTLGTGFALLACAVAAIAAVLKSASAAKKGGTMML----LLT 134
            .:.:|...:...:..:   |.|:..|   ..:|:.|.:.:::|....::........|    :.|
Mouse    73 KNFEVLGILDNSSQKS---LHLVVIL---LLILSLAASVLSSVFTFYNSISNPYQTFLGPMGVYT 131

  Fly   135 SNICAAGAQIVAFVAWLVQFYQYFIHNVL-------LTEQQQQHWYSNGLAYLGYSFYLVVVSTV 192
            .|..:|....:|.|.::.......:.:.|       .|.::..|.|       ||||:|.:   .
Mouse   132 WNGLSASFVFLAMVLFVGNAESNHLSDKLSQKLYPDTTNKRTTHTY-------GYSFWLTL---H 186

  Fly   193 VVLLNI---AILLYAQRLGLRNRQCLEAPCDDKNKTAIM 228
            |:.|||   .|:::.|:...|.:|....|.:...:..|:
Mouse   187 VIFLNIVTAVIIIFYQKARYRQKQEQRKPVEYAPRDGIL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1103NP_001036660.1 Claudin_2 22..203 CDD:258170 41/200 (21%)
Clrn3NP_848784.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31548
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.